KEGG   Thermodesulfobacterium geofontis: TOPB45_1598Help
Entry
TOPB45_1598       CDS       T01547                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00010  Glycolysis / Gluconeogenesis
top00020  Citrate cycle (TCA cycle)
top00620  Pyruvate metabolism
top00633  Nitrotoluene degradation
top00640  Propanoate metabolism
top00650  Butanoate metabolism
top00680  Methane metabolism
top01100  Metabolic pathways
top01120  Microbial metabolism in diverse environments
top01130  Biosynthesis of antibiotics
top01200  Carbon metabolism
Module
top_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_1598
   00020 Citrate cycle (TCA cycle)
    TOPB45_1598
   00620 Pyruvate metabolism
    TOPB45_1598
   00640 Propanoate metabolism
    TOPB45_1598
   00650 Butanoate metabolism
    TOPB45_1598
  Energy metabolism
   00680 Methane metabolism
    TOPB45_1598
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TOPB45_1598
Enzymes [BR:top01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TOPB45_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF3349
Motif
Other DBs
NCBI-ProteinID: AEH23676
UniProt: F8C3V2
Position
1603528..1604085
Genome map
AA seq 185 aa AA seqDB search
MIEIRIHGRGGQGAVTSAELIAVAAINEGKFAQAFPSFGPERRGAPVQAFARIGEERIRT
REKIYHPDIILVLDPSLPKITKVTEGLKENGVAILNSHLSEEEVRKILGDYKGKLALVNA
TKIAIEEIGVPITNTTMLGALLKATGLIEVKSMEEALKERFGKLAEKNIKALHRALEETQ
IYKGV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaataagaattcatggaagaggaggtcaaggagctgtaacctctgctgaattg
attgctgtagcagctattaatgaaggtaaatttgcccaagcatttcccagttttggacca
gaaagaagaggagcacctgttcaggcttttgcaagaattggagaagaaagaataagaaca
agagaaaaaatatatcatcctgatataattttggtgcttgatccatctcttcctaaaata
actaaggttactgaaggattgaaagaaaatggcgtagctattttgaattcccatctttct
gaggaggaggttagaaaaattttaggagattataaaggtaaacttgctttagttaatgca
actaaaattgctattgaagaaataggtgtccctattactaatactactatgttaggggct
cttcttaaagctacaggacttattgaagttaaaagtatggaagaagcattaaaggaaagg
tttggtaaacttgctgaaaagaatattaaagctttacacagagctttagaagaaactcaa
atttataaaggagtataa

DBGET integrated database retrieval system