KEGG   Thermodesulfobacterium geofontis: TOPB45_1600Help
Entry
TOPB45_1600       CDS       T01547                                 

Definition
(GenBank) Pyruvate synthase (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TOPB45_1600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_1600
   00020 Citrate cycle (TCA cycle)
    TOPB45_1600
   00620 Pyruvate metabolism
    TOPB45_1600
   00640 Propanoate metabolism
    TOPB45_1600
   00650 Butanoate metabolism
    TOPB45_1600
  Energy metabolism
   00680 Methane metabolism
    TOPB45_1600
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TOPB45_1600
Enzymes [BR:top01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TOPB45_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1604386..1605555
Genome map
AA seq 389 aa AA seqDB search
MGKRLAKEVSIAIAEAVAQCKVDVISAYPITPQTHIVEHLAELVNNGELEAEYMPVESEH
AAMSACIGAAATGARTFTSTSAQGLLLMYENLFIASAFRLPIVMVIANRSISAPISIWND
HSDVMTMRDSGWITTFAENGQEAVDLIYHAYRVAEKALLPVAVNIDGFTLSHVIEPIELL
DQELVDKYIPPLRMKYKLDPKKPITMGAIGVPEIYTEAKKAQDEAFKASYKIIVNAWKEF
EKLTGRRYQPVETYQMEDAEVALLIMGSLAETAMNAVDFLRKKGKKVGLLRFRLWRPFPL
KDFLRAIGKIRALGVIDRAVSHGSTGGPVGIEVRSALYQSNKRPKVVNFIAGLSGRDVTV
DDFVELFEKTYEAINKKPKFSYEIYGVKE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaagattagctaaagaggtttctattgctatagctgaggcagttgctcagtgt
aaagttgatgtaatttctgcttacccaattactcctcaaactcatattgttgaacactta
gctgaacttgtaaataatggggaattagaagctgaatatatgcctgttgaatctgaacat
gcagctatgagtgcctgtataggtgcagctgcaacaggtgcaagaacttttacctctacg
tctgctcagggattacttttaatgtatgaaaatctttttattgcttctgcttttagactt
ccaattgtaatggttattgctaatcgttctatttctgctcctataagtatatggaatgat
cactcagatgtgatgactatgagagattctggatggataactacttttgctgaaaatggg
caagaagcagtagatcttatatatcatgcttacagagttgctgaaaaggctttacttcca
gttgcggtaaatattgatggatttaccctttctcatgtaatagaacctattgagctttta
gaccaggaattagttgacaaatatattcctcctcttcgtatgaaatataaattagatcct
aaaaaacctattacaatgggagctataggggtcccagaaatctatactgaagcaaaaaaa
gctcaagatgaagcttttaaagcttcttataaaattatagtaaatgcttggaaagaattt
gaaaaattaacaggaagaagatatcaacctgttgaaacttatcaaatggaagatgctgag
gttgctcttcttattatgggaagtcttgctgaaacagctatgaatgcagttgattttttg
aggaaaaaaggaaaaaaagtaggacttttaagatttagactctggagaccctttccttta
aaagattttttaagagctataggaaaaataagagctttgggagttatagatagagctgta
agtcatggctcaacaggaggtcctgtaggaatagaggtacgttctgctctataccagtct
aataaaagacctaaggtagtaaattttatcgctggactttctggaagagatgtaacagta
gatgattttgttgaactttttgaaaaaacctatgaagctattaataaaaaaccaaagttt
tcctatgaaatttatggagtaaaggagtaa

DBGET integrated database retrieval system