KEGG   Thermodesulfobacterium geofontis: TOPB45_1601Help
Entry
TOPB45_1601       CDS       T01547                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
top  Thermodesulfobacterium geofontis
Pathway
top00010  Glycolysis / Gluconeogenesis
top00020  Citrate cycle (TCA cycle)
top00620  Pyruvate metabolism
top00633  Nitrotoluene degradation
top00640  Propanoate metabolism
top00650  Butanoate metabolism
top00680  Methane metabolism
top01100  Metabolic pathways
top01120  Microbial metabolism in diverse environments
top01130  Biosynthesis of antibiotics
top01200  Carbon metabolism
Module
top_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:top00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TOPB45_1601
   00020 Citrate cycle (TCA cycle)
    TOPB45_1601
   00620 Pyruvate metabolism
    TOPB45_1601
   00640 Propanoate metabolism
    TOPB45_1601
   00650 Butanoate metabolism
    TOPB45_1601
  Energy metabolism
   00680 Methane metabolism
    TOPB45_1601
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TOPB45_1601
Enzymes [BR:top01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TOPB45_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF3629
Motif
Other DBs
NCBI-ProteinID: AEH23679
UniProt: F8C3V5
Position
1605560..1606513
Genome map
AA seq 317 aa AA seqDB search
MRPELKDFKGFNLKKLPEYDGFAPGHRACQGCGTVLPLKLALKALGPNTIAVSATGCMEI
ISSPFPYTSWRVPWIHVAFENSASVASGIEAAIKVLKRKGKISKREKINVVVFAGDGATF
DIGLQFLSGALERGHDFIYICLDNEAYMNTGVQRSSATPFGAHTTTSPAGKVIKGQVTWK
KNLMGIVVAHNIPYAATASPAYPVDLMNKVKKASLVNGPAFLHVFSPCPTGWGCKSEDSV
LLAKLAVETRIFPLYEVIDGKYILNRKIDKPKPIEEYFKLQRRFRHLTPEQIEYIKKRVD
EEYEKVVKLSECFGIES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagaccagaactaaaagattttaaaggttttaatttaaaaaaattacctgaatatgat
ggatttgctccaggacatagagcctgtcaaggttgtggaacagttttacctcttaaatta
gctttaaaagcactcggaccaaatacaattgcagtatcagctacaggttgtatggaaatt
atttcaagcccctttccatatacttcttggagagtgccatggatacatgtagcctttgaa
aattcagcttcagttgcttcgggaattgaagcagccattaaagttttaaaaagaaagggt
aaaatctctaaaagagaaaagataaatgtagttgtttttgcaggagatggagcaactttt
gatataggacttcagtttctttctggagctttagaaagggggcatgattttatttatatt
tgtcttgataatgaagcctatatgaatacaggtgttcaaagatcaagtgctactcctttt
ggagctcatacaactacaagccctgctggaaaagttataaaagggcaagtcacttggaaa
aaaaatcttatgggaatagtagttgctcataatattccttacgcagcaacagcaagtccc
gcctatcctgttgaccttatgaataaggtaaaaaaagcatccttggtaaatggacctgct
ttccttcatgtattttctccttgtccaacaggatggggttgtaaaagtgaagatagtgtt
ttacttgctaaattagctgtagaaacaagaatttttcctctttatgaggttatagatgga
aaatatatccttaacagaaaaattgataagccaaaacctatagaagagtattttaaattg
caaagaagatttaggcatttaactccagagcaaatagaatatattaaaaaaagggtagat
gaggaatacgaaaaagttgttaaactttctgaatgttttggtatagaatcttaa

DBGET integrated database retrieval system