KEGG   Thalassolituus oleivorans R6-15: R615_06700Help
Entry
R615_06700        CDS       T03056                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R615_06700
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    R615_06700
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    R615_06700
Enzymes [BR:tor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     R615_06700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
1438901..1440250
Genome map
AA seq 449 aa AA seqDB search
MLLNRSSIKTYVLSMWFIGISMLSYSVEAAVQTDGPMVGAVTHVRAKVFLRTDAPAQVQI
EFSESSSMSNSLKTPKEVTRYANDFTKIVTLKGLIPSTKYYYRVLVDGVAQQTENYPSFT
TFAPLGQDAEFSFGLLSDVGNYVKNPAGAYKTLADAKPDFVLQIGDWDHRDPANLREMRK
MHRDVRGSGSDAGADFSQFLAPVAPLFHMWDDHDYGMNDGDYTFPEKASAIKAFLEYYPL
PDLPNPQAGPWYKFRYAQAEFFVLDTRSNRDPNTDVDDANKSMLDGENIENDQKTWLYDS
LLTSPAKWKFITSGSPFNPTCKPADGWGAFVNEHDEIVNFIKDNNIKGVIILSGDIHSGG
ALDDGTNSGLIEFSVPHTNMQMSPANGGFTTTTPGDWSEYLNPGVSASGSSNAGFGWINV
LTNPDRVEIQVVHENGDVANSDTIIFDEM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttattgaatcgcagtagtatcaaaacctatgtgctgagcatgtggtttattggcatt
tctatgctctcgtatagcgttgaagctgcggtgcagacagacggccctatggtgggtgct
gttacgcatgttcgcgcaaaggtattccttcgtactgacgcgcctgcgcaggttcagatc
gagtttagtgaatcttcgagtatgagtaactcactcaaaactccaaaagaagtaacgcgt
tatgctaatgattttactaaaattgttacccttaaaggtttaattcctagcactaagtat
tattaccgagtgttggttgatggtgttgcgcaacaaacagaaaactatccaagctttaca
acctttgccccattagggcaagacgctgaattctcgtttggtttattaagcgatgttggt
aactacgttaaaaacccagcgggtgcttataaaacattagccgatgccaaacctgatttt
gtgttgcaaatcggggattgggaccatagggatccagcgaatttacgggagatgcgcaag
atgcatcgcgacgttcgtggttctggttcggatgctggcgctgattttagtcagttctta
gcacctgtcgctcctttatttcatatgtgggatgaccacgattacggtatgaacgatggc
gattataccttcccagaaaaagccagcgctattaaggctttcctagaatattatccattg
cccgacctaccaaaccctcaggctggcccttggtataagtttcgctatgcacaagctgaa
ttctttgtattagatactcgttctaatcgcgatccgaatacagatgtcgatgatgctaat
aaatctatgctcgatggcgaaaatatcgagaacgaccagaaaacttggctgtatgatagt
ttgttaacgtcgcctgctaaatggaaatttattacttctggtagtccatttaatccgacg
tgtaagcctgccgatggttggggagcctttgttaatgagcatgatgaaattgtcaatttt
attaaagacaataatataaaaggcgtgattattttatccggcgatatacactcaggcggt
gcattggatgatggtacgaactctgggttaatagagttttcggttcctcataccaatatg
caaatgtcgccagctaatggcggttttactacaacgactccaggtgattggtcagagtat
ttaaaccctggggtaagcgcaagtggcagtagtaatgcggggtttggttggattaatgta
ttgaccaatcctgatcgggtagaaattcaagttgttcatgaaaatggtgacgtggcaaat
agcgatactattatttttgatgaaatgtga

DBGET integrated database retrieval system