KEGG   Thalassolituus oleivorans R6-15: R615_07300Help
Entry
R615_07300        CDS       T03056                                 

Definition
Stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    R615_07300
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    R615_07300
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     R615_07300
Lipid biosynthesis proteins [BR:tor01004]
 Desaturase
  First
   R615_07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1550796..1551935
Genome map
AA seq 379 aa AA seqDB search
MSEQHNKENAPINWVPAIMFAVTTLGVLTIVPWYGITYGYSTSAWVAYAVITWLTGMSIT
GGYHRLWSHNSYDAHPILRVWYALWGAAALENTILHWASGHRVHHRHVDDVELDPYSAKR
GFWFSHMGWMLREYKSGIPNFDNVKNLMKDPIVMWQYKYYGPIVLVMNIGVPLALGFIFG
DVWGMLLLAGLLRIVTTHHVTFFINSIAHKWGSQPYTDENTARDNAFFAFLTHGEGYHNY
HHIFQTDYRNGIRWYHWDPTKWFIAACSWVGLTSNLRVVPDFKIERAKVKMQFKHAQEKL
AKAENSEKWTVLLEKEYEEFREMLNEWTELQSERLDETRKHLREKWESAAIHTRFKELDY
SLKMQSKRLQAMMAEARVA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaacataataaagaaaacgcaccgatcaactgggtgccggcaattatgttt
gccgtcacaacactcggtgttcttaccatcgtgccttggtacggaatcacctatggttac
agcacgtctgcatgggttgcatacgcagtaatcacttggctaaccggcatgagcattact
ggcggttatcatcgcctatggtctcataatagctatgacgcccatccaatactgcgtgtt
tggtacgcactatggggcgcggcagcactcgaaaatactattttgcactgggcttcaggc
caccgtgttcaccatcgtcacgttgatgacgttgagctagatccatactctgcaaaacgc
ggtttttggttctctcatatgggttggatgctacgcgaatacaaaagcggcattcctaac
ttcgacaatgtcaaaaatctaatgaaagacccaattgtaatgtggcagtacaagtactac
ggcccaatcgtactggttatgaacatcggtgtgccgttggcgctcggttttatattcggc
gatgtatggggcatgttactactggctggtttgttgcgtattgtgactactcaccacgta
accttcttcattaactcaattgctcacaagtggggctcgcagccatacacagatgagaac
accgcacgtgataacgcattcttcgcgtttttaacacacggtgagggttaccataactac
caccatattttccaaacagattaccgtaatggtattcgttggtatcactgggacccaacc
aagtggttcatcgccgcctgttcatgggttggtttgactagcaatctccgcgtagtgcca
gatttcaaaatcgaacgcgctaaagtgaaaatgcagtttaagcatgcccaagaaaaacta
gcaaaagctgaaaactcagagaagtggacagttctgctagaaaaagaatacgaagagttc
cgcgaaatgctgaacgagtggaccgagcttcaatcagaacgtttggacgaaactcgtaag
catttacgagagaagtgggaatccgcagcgattcatacgcgctttaaagaactagattat
tctttgaaaatgcagagcaagcgtctgcaagcaatgatggcggaagctcgcgttgcttaa

DBGET integrated database retrieval system