KEGG   Thalassolituus oleivorans R6-15: R615_11265Help
Entry
R615_11265        CDS       T03056                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00071  Fatty acid degradation
tor00280  Valine, leucine and isoleucine degradation
tor00310  Lysine degradation
tor00362  Benzoate degradation
tor00380  Tryptophan metabolism
tor00620  Pyruvate metabolism
tor00630  Glyoxylate and dicarboxylate metabolism
tor00640  Propanoate metabolism
tor00650  Butanoate metabolism
tor00900  Terpenoid backbone biosynthesis
tor01100  Metabolic pathways
tor01110  Biosynthesis of secondary metabolites
tor01120  Microbial metabolism in diverse environments
tor01130  Biosynthesis of antibiotics
tor01200  Carbon metabolism
tor01212  Fatty acid metabolism
tor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    R615_11265
   00630 Glyoxylate and dicarboxylate metabolism
    R615_11265
   00640 Propanoate metabolism
    R615_11265
   00650 Butanoate metabolism
    R615_11265
  Lipid metabolism
   00071 Fatty acid degradation
    R615_11265
   00072 Synthesis and degradation of ketone bodies
    R615_11265
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R615_11265
   00310 Lysine degradation
    R615_11265
   00380 Tryptophan metabolism
    R615_11265
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R615_11265
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R615_11265
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    R615_11265
Enzymes [BR:tor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R615_11265
Exosome [BR:tor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R615_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHK16229
UniProt: W8G266
Position
complement(2405296..2406591)
Genome map
AA seq 431 aa AA seqDB search
MTQTVRRVAIIGGNRIPFARSNSAYSYASNQDMLTAALNGLVNRYNLQGEHIGEFIAGAV
IKHSRDFNLARETLLSTALSPRTVGCDLQQACGTGLQAIMMAANKIALGQIDSAIAGGSD
TTSDAPIGVSEGLRKILLEANRQKTTKDKLKQLMKIRPKHLAPLVPRNGEPRTNMSMGEH
TELTVKAWGITREEQDQIAFNSHQNLLAAYDRGFFDDLVTPFQGVEKDNLARTPNMEKLA
SLKPAFDKKSGNGTLTAGNSSALTDGASVVLLASEEWAKERNLPVKAYLSFYETAAVDFF
GKDGNKDKEGLLLAPAYAVPAMLKRAGITLQDFDFYEIHEAFAGVVCSTLKAWEDEKFCK
EKLGLDAPLGSIDRSKLNVNGSSIATGHPFAATGGRIVASLAKMLEEKGSGRGLISICAA
GGQGVVAIIER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacagttcgtagagtcgccatcattggcggtaaccgtattccgttcgcacgt
tctaacagcgcttattcatacgcgtctaaccaagacatgttgactgctgcattgaatggc
ttggtcaatcgttacaatctgcaaggcgagcacatcggtgaattcatcgctggcgctgtt
atcaaacacagccgcgatttcaacttggctcgtgaaactttgttaagcactgcattaagc
ccacgtactgttggttgcgatcttcagcaagcatgcggtactggtttacaagccatcatg
atggcagcgaacaaaatcgctttgggccaaatcgacagtgctattgctggtggttctgat
accacgtctgacgcacctatcggcgttagcgaaggtttgcgtaaaattttgttagaagct
aaccgtcaaaaaacgacgaaagacaagctgaagcaattgatgaaaattcgtcctaagcat
ttggcgcctcttgtacctcgcaacggtgaaccacgtactaatatgtcgatgggcgagcac
actgagctgaccgttaaagcttggggcattactcgcgaagagcaagatcaaattgccttc
aacagccatcagaacttgttagctgcttatgatcgtgggtttttcgacgatcttgtgacg
ccgtttcaaggtgttgagaaagataacttggcacgtacgccaaacatggaaaagctagca
agcctgaaaccagcattcgataagaagtctggtaacggtacgctaacggctggtaactca
tcagctctgactgacggtgcatcggttgtattgttagctagcgaagaatgggcaaaggag
cgcaacctgccggttaaagcttacttaagcttctacgaaactgctgcggttgatttcttc
ggtaaagatggcaacaaagacaaagaaggtttgttgttggcgcctgcatacgctgttcct
gcaatgcttaagcgtgctggtattactctacaagatttcgatttctacgaaatccacgaa
gcctttgctggtgttgtttgttcaacattaaaagcgtgggaagacgagaaattctgtaaa
gagaagttaggcttagatgcgccactaggcagcattgatcgtagcaagcttaacgtaaac
ggttcttccattgccactggccacccatttgcggcaaccggcggtcgcatcgtagcttcc
ctggctaagatgttggaagaaaagggctctggtcgtggccttatctccatctgtgctgca
ggtggccaaggtgttgttgcgatcattgagcgctga

DBGET integrated database retrieval system