KEGG   Thalassolituus oleivorans R6-15: R615_12970Help
Entry
R615_12970        CDS       T03056                                 

Definition
metallophosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R615_12970
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    R615_12970
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    R615_12970
Enzymes [BR:tor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     R615_12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2784094..2785110
Genome map
AA seq 338 aa AA seqDB search
MLLRSIVLMAALSSTSAWAQEPTRILFGSCMHQDKPTTILTAINKVDADLFVFLGDNIYG
DTEDMAILKKKYTKLGSKPELVKLRERMPVIAIWDDHDFGENDAGKEYPKKEESRQIMLD
FWGAEADDIRRTQTDGIYTSYWLEKDGKRVHVILPDLRWNRDALTSVDRATYDKEKAPKN
LGPYLPAVGRSMLGEHQWQWLEAELQKPADLTIMGSSIQALSDFTGWESWANFPDDRNRL
LTLVEEKNLHNLILISGDTHWGEFSKVDVNGIPLWELTSSGLDMEWKQVSPNQNRIGKDY
SSVNFGDILIDWDNHLVTMSLRDEQGDAFASHELPLSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacgctcaatcgtattaatggcggctttatccagtacttccgcatgggcgcaa
gaaccaacacgtattttgtttggttcttgcatgcatcaagataagcccaccaccatttta
acagccatcaataaagtggatgccgatctatttgtttttttaggagacaatatttacggc
gacacagaagatatggctattttaaagaaaaaatacaccaaactaggtagcaaaccagaa
ctcgtaaagctgcgtgaacgtatgcctgttatcgccatttgggatgaccatgattttggt
gaaaacgacgctggcaaagaatatccgaagaaagaagaatcacggcaaatcatgctcgat
ttttggggcgctgaagcagacgatattcgtcgtactcaaaccgatggcatctacaccagt
tactggctagagaaagatgggaaacgtgttcacgttattcttcccgatttacgctggaat
cgtgatgcattaacgtctgtcgatcgtgcaacctacgataaagagaaagcaccgaaaaat
ctggggccttaccttcccgcagttggccgttctatgctgggtgaacatcaatggcaatgg
ctcgaagctgagctacaaaagcctgctgacctaacgattatgggctctagcattcaagca
ctttcagattttacgggatgggagtcttgggccaatttccctgatgaccgtaatcgcttg
ttaaccttggtggaagaaaaaaatctgcataacctaattcttatcagtggcgatacgcac
tggggcgaatttagtaaagtagacgtgaatggcataccactatgggaactgaccagctca
ggtctggatatggaatggaagcaagtcagtccaaaccaaaatcgcattggaaaagactat
agctcagttaacttcggtgatattttgatcgactgggacaatcacttagtcaccatgtct
ctaagagacgaacaaggtgacgctttcgctagtcacgagttaccgttaagcaaataa

DBGET integrated database retrieval system