KEGG   Thalassolituus oleivorans R6-15: R615_14885Help
Entry
R615_14885        CDS       T03056                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00790  Folate biosynthesis
tor01100  Metabolic pathways
tor02020  Two-component system
Module
tor_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R615_14885
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    R615_14885
Enzymes [BR:tor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     R615_14885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: AHK16745
UniProt: W8FZW9
Position
complement(3207304..3208941)
Genome map
AA seq 545 aa AA seqDB search
MPLSRREFLLDSAGSTLLAPLFRLPSSRRGFPFRHGVASGDALTDRVILWTRISSDHDAA
SVGFRYVVALDQDLKNRVVDAYGVTDSSRDFTVKIDVDGLQANTTYFYAFEALGQWSDTG
RTRTLPEGSCEHLRIAFTSCSNFAQGYFNVYRDLAARTDLDAILHLGDYIYEYANLEESL
TSGRVHEPAREAITLADYRARHACYKSDRDLQQVHRQHGFYIIWDDHEVANNAWLGGAGN
HDEATEGVWQDRLAGAVQAYFEWMPVREPVNQQGVYRNVRFGDLLDLNMLDTRLAGRDAQ
AETLEERNRSDRTLLGHPQEQWLSECLQAAQQQGVRWKVMGQQVMVAQLGTNDRPFNYDQ
WDGYPAARQRLFDSVRAANVENWVVLTGDIHSSWAMTLHDDPFADLPTPALGVELVTPGV
TSPGITQYAQAKLAASSLEALLPHLEFVDFYYRGYVLLDITHERMQAEWWVVDKVDNYKY
RSDCLRALQIPAGEATFIVAPEITAPKQQDFADIPSFSGEFAYLREWRRPENQGVDGMIA
AQASR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcctctttcgcgtcgtgagtttttgttggatagcgctggtagtacattgctcgcgccc
ttgtttcgtttaccgtcatcgcgtcgcggatttccatttcgtcatggcgtggcaagtggc
gatgctctaaccgaccgagtcatattatggactcgaatatcttccgatcatgatgccgcc
agtgttggctttcgctatgtcgtcgctttggatcaagatttgaaaaacagggtcgtcgat
gcctacggagttacggattctagtcgcgattttacggttaagattgatgtcgatggcttg
caagcaaacaccacgtatttttatgcttttgaagctttaggtcagtggtcggacacaggg
cgaactcgcactttgccagaaggttcatgcgagcatctacgtattgcatttacctcctgt
tctaactttgcccaaggttattttaatgtttatcgcgatttagccgcgcgtactgatctc
gatgctattttgcatctcggtgattacatttatgaatatgctaacctcgaagaaagccta
acaagcggacgtgtgcatgagcctgctagagaggccattactctggctgattatcgtgca
cgccatgcttgctacaagagtgatcgtgatttacaacaagtacatcgtcagcatggtttc
tacattatttgggatgatcatgaagttgctaataacgcatggctaggcggtgcaggtaat
catgatgaagcgaccgaaggtgtatggcaggatcgtttagcaggagctgttcaagcctat
tttgaatggatgccggtgcgcgaacccgttaatcaacaaggggtttatcgcaatgttcgt
tttggtgatttactcgacttaaacatgttagatacgcgcctagccggtcgcgatgcccaa
gctgaaaccttggaggaacgtaaccgcagcgaccgaaccttgttgggccatcctcaagag
caatggttaagtgagtgtttgcaagccgcgcagcagcaaggagtgcgttggaaagtcatg
ggtcaacaggtcatggtggcgcagcttggtaccaatgaccgtccttttaattacgatcaa
tgggacggatacccagcggcaaggcagcgcttattcgacagtgttcgcgcagcaaatgtt
gaaaactgggtggtattaaccggcgatattcattcgagttgggcaatgaccttacatgat
gatccattcgcagatttaccgacacctgcgctgggggttgaattagtgacgccgggggtg
acctcaccagggattacccagtatgcgcaagcaaaattagcagcgtcttcgctagaagcc
ttactaccacatcttgaatttgttgatttttattatcgtggctatgtgctgttagatatt
acccatgagcgtatgcaggctgaatggtgggtcgtcgataaggtcgataattataaatat
cgcagtgattgtttgcgtgcattacagattccagcaggcgaagcaacatttattgtggct
ccagagattacagcacctaagcaacaagactttgccgatataccgagtttttctggtgaa
tttgcctacttgcgggaatggcggcgaccagaaaaccaaggtgtcgatggtatgatcgcc
gcacaagcatcacgttaa

DBGET integrated database retrieval system