KEGG   Thermus oshimai: Theos_0135Help
Entry
Theos_0135        CDS       T02346                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tos  Thermus oshimai
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tos00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Theos_0135
Enzymes [BR:tos01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Theos_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125647..126216
Genome map
AA seq 189 aa AA seqDB search
MIRHLKGKVLFKEEGGFVLEVGGVGFFLQAPEPFLREVREGEEVSVHTHLLAKEEGLFLY
AFPDGESHRLFGLLLSVSGVGPKVALALLSALGPRLLAQALSEGDVKLLTSASGVGKRLA
ERIALELKGKVPPVAAPAVQGAAVEEAVLALLALGFREGAARAAVLEALSKAPSAKAQEL
IKEALKRLR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatccgccaccttaaggggaaggtcctcttcaaggaggagggggggttcgtcctggag
gtggggggggtggggtttttcctccaggcccccgagcccttcctgcgggaggtgagggag
ggggaggaggtttccgtccacacccacctcctcgccaaggaggagggccttttcctctac
gccttccccgacggggagagccaccgcctcttcgggcttctcctttccgtctccggcgtg
gggcccaaggtggccctggccctcctctccgccctggggccgaggcttttggcccaggcc
ctttccgagggggacgtgaagctcctcacctccgccagcggggtggggaagaggctcgcg
gaaaggatcgccttggagctcaaggggaaggtgcccccggtggccgccccggcggtccag
ggggcggcggtggaggaggccgtcctcgccctcctggccctgggcttccgcgagggggcg
gcccgggcggcggtgctggaggccctttccaaggccccttccgccaaggcccaggagctc
atcaaggaggcccttaaacggctccgctga

DBGET integrated database retrieval system