KEGG   Thermus oshimai: Theos_0143Help
Entry
Theos_0143        CDS       T02346                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tos  Thermus oshimai
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theos_0143
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theos_0143
   00052 Galactose metabolism
    Theos_0143
   00500 Starch and sucrose metabolism
    Theos_0143
   00520 Amino sugar and nucleotide sugar metabolism
    Theos_0143
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theos_0143
   00524 Butirosin and neomycin biosynthesis
    Theos_0143
Enzymes [BR:tos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theos_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130308..131213
Genome map
AA seq 301 aa AA seqDB search
MTVVGLDLGGTKIAAGAFDGERLLSEVVLPTPKEGGMRVVEALAEAALRAEAEAGVRAEA
FGLGTPGPLDFARGLIRFTPNIPGLKDFPIRDLLRERLGRPVHLENDANAAALAEHHLGA
ARGEESSLYLTVSTGIGGGVVLGGRVLRGVRGQGGELGHITLLPGGPACGCGLEGCLEAL
AAGRALEREAGYAYGLPVDTRELFRRYGAGDPKAERILLQAARYVGLGLASLVKAFDPGA
VVVGGGVALNAPEGYWQALEGAYRHYLQGWEVPPLRKALLGARAGLLGAALTAYLEGDGA
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggtggggctggacctgggggggaccaagatcgccgcgggggcctttgacggg
gaaaggctcctttcggaggtggtcctccccacccccaaggagggggggatgcgggtggtg
gaggccctggcggaggccgccctacgggcggaggccgaggccggggtgcgggcggaggcc
tttgggcttggcaccccggggcctttggacttcgctaggggcctcatccgcttcaccccc
aacatcccagggcttaaggacttccccatccgggacctcctgagggaaaggcttggccgc
cccgtccacctggaaaacgacgccaacgccgccgccctcgccgagcaccacctgggggcg
gcccggggggaggagagctccctctacctcaccgtgtccacggggatcgggggcggggtg
gtcctgggggggcgggtcctccggggggtgcgggggcaggggggggagctcggccacatc
accctcctccccggggggcccgcctgcgggtgcggcctcgagggctgcctcgaggccctg
gccgcgggccgggccctggagcgggaggcgggctacgcctacgggcttccggtggacacc
cgcgagctcttccgccgctatggggcgggggaccccaaggcggagcgcatcctcctccag
gccgcccgctacgtgggcctgggcctggccagcctggtgaaggcctttgaccccggggcg
gtggtggtgggcgggggggtggccctgaacgcccccgagggctactggcaggccctggag
ggggcctaccgccattaccttcagggctgggaggtgccccccctcaggaaggcccttttg
ggagcccgggcggggcttctgggggcggccctcacggcgtatcttgagggggatggagct
cggtaa

DBGET integrated database retrieval system