KEGG   Thermus oshimai: Theos_0152Help
Entry
Theos_0152        CDS       T02346                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tos  Thermus oshimai
Pathway
tos00790  Folate biosynthesis
tos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theos_0152
Enzymes [BR:tos01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Theos_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFV75235
UniProt: K7QXP7
Position
complement(140215..140823)
Genome map
AA seq 202 aa AA seqDB search
MERRMVEIEETGLSFVTEVDLERLQALSEEWLRLIGEDPEREGLKKTPERVAKAWAFLTR
GYRQSLEEIVNGAIFQAEGSEMVVVKGIEFYSLCEHHMLPFFGQVHIGYIPNQKILGLSK
FARIVDMFARRLQVQERLAVQIAEAIQEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVT
SAMLGVFRESAKTREEFLDHLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcagaatggtggagattgaagaaaccggcctgagcttcgtcacggaagtggac
ctggagcgcctgcaggccctttccgaggagtggctcaggcttatcggcgaggacccagag
cgggaaggccttaagaaaaccccggagcgggtggccaaggcctgggccttcctcacccgg
ggctaccggcagagcctggaggagatcgtcaacggcgccattttccaggcggaggggagc
gagatggtggtggtcaaggggattgagttctactccctctgcgagcaccacatgctcccc
ttcttcggccaggtgcacatcggctacatccccaaccagaagatcctggggctttccaag
ttcgcccgcatcgtggacatgttcgcccgccgcctccaggtgcaagagcgcctggcggtg
cagatcgcggaggccatccaggaggtcctggagccccagggggtgggggtggtggtggag
ggggtgcacctctgcatgatgatgcggggggtggagaagcagcactcccgcaccgtcacc
agcgccatgctgggggtgttccgggaaagcgccaaaacccgggaggagttcctggaccac
ctaaagtaa

DBGET integrated database retrieval system