KEGG   Thermus oshimai: Theos_0187Help
Entry
Theos_0187        CDS       T02346                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tos  Thermus oshimai
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Theos_0187
Enzymes [BR:tos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Theos_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183462..184040
Genome map
AA seq 192 aa AA seqDB search
MLAKLFSTFRQVGEDLFAQGLISATAGNFSARTKEGFLITKSGVQKAHLTPEDLLEVPLV
GPIPPGASVESVIHRAVYRETGARAIVHAHPRVAVALSLHLDRLVPLDLEGQLYLKEVPV
LSPKTLSATEEAALAVAEALKRHPVCLLRGHGAFARSEKEKPEEALLHAYSLLTTLEESA
AILLYSRLWGGA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaagctcttttccaccttccgccaagtgggggaggacctcttcgcccagggg
ctcatctccgccaccgcggggaacttttccgcccgcaccaaagaggggttcctcatcacc
aaaagcggggtgcagaaggcccacctcaccccagaagacctcctggaggtgcccctcgtg
ggccccatccccccgggggccagcgtggagagcgtgatccaccgggcggtctaccgggaa
acgggggccagggccatcgtccacgcccatccccgggtggcggtggccctctccctgcac
ctggaccggctcgttcccctggacctcgagggccagctctacctcaaggaggtccccgtc
ctctcccccaagaccctctccgccacggaggaggccgcccttgccgtggcggaggccttg
aagcgtcatccggtctgcctcctaagggggcacggggccttcgcccgctcggagaaggaa
aagcccgaggaggccctcctccacgcctatagcctcctcaccaccctggaggagtccgcg
gccatcctcctctatagccgcctctgggggggtgcatga

DBGET integrated database retrieval system