KEGG   Thermus oshimai: Theos_0554Help
Entry
Theos_0554        CDS       T02346                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tos  Thermus oshimai
Pathway
tos00240  Pyrimidine metabolism
tos00250  Alanine, aspartate and glutamate metabolism
tos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Theos_0554
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Theos_0554
Enzymes [BR:tos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Theos_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AFV75618
UniProt: K7QW40
Position
complement(505632..506537)
Genome map
AA seq 301 aa AA seqDB search
MRHLLDFQGWTRGEVENLLDTAKVMREVLERPVKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFTAATSSLQKGESYKDTLLTLEAMGVDAYILRADSAGVPHQATRWVKG
AVVNAGDGRRAHPTQALLDAYTLLEALGGLEGKKIAIVGDILHSRVARSNAELLSLLGAE
VWCAGPPSLLPQALPGARLTPRLDEALEEADAVMVLRLQKERMEAGLVQLEDYIAHYQVT
EARLGRAKPHAPLLHPGPMNRDVELEGHLADSPRSLVQRQVQNGVAVRMAVLYHVLVGRE
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggacgaggggcgaggtggaaaacctcctggac
accgccaaggtgatgcgggaggttttggagaggcccgtgaagaaggtccccgccctccag
ggcttcaccgtggccacagtcttctttgagccctccacccgcacccgcatctcctttgag
ctggcggcccggcgcatgtccgcggacgtggtctccttcaccgcggccacgagctccctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacatcctccgcgcggacagcgccggggtcccccaccaggccacccgctgggtgaagggg
gcggtggtgaacgccggcgacggccgccgggcccaccccacccaggccctcctggacgcc
tacacccttctggaggccttagggggcctggagggcaagaagatcgccatcgtgggggat
atcctccactcccgggtggcccgctccaacgcggagcttctgagcctcttgggggccgag
gtgtggtgcgcggggcccccaagcctcctcccccaggccctccccggggcccggctcacc
ccgcgtctggacgaggccttggaggaggcggacgcggtcatggtcttgaggctccaaaag
gagcggatggaggcggggcttgtccagctggaggactacattgcccactaccaggtgacg
gaggcccgcctagggagggccaagccccacgcccccctcctccaccccggccccatgaac
cgggacgtggagctggagggccacctggcggactccccgaggagcctggtccaaaggcag
gtgcaaaacggggtggcggtgcgcatggccgtgctctaccacgtgctggtggggagggag
ggttaa

DBGET integrated database retrieval system