KEGG   Thermus oshimai: Theos_0554Help
Entry
Theos_0554        CDS       T02346                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tos  Thermus oshimai
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tos00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tos00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(505632..506537)
Genome map
AA seq 301 aa AA seqDB search
MRHLLDFQGWTRGEVENLLDTAKVMREVLERPVKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFTAATSSLQKGESYKDTLLTLEAMGVDAYILRADSAGVPHQATRWVKG
AVVNAGDGRRAHPTQALLDAYTLLEALGGLEGKKIAIVGDILHSRVARSNAELLSLLGAE
VWCAGPPSLLPQALPGARLTPRLDEALEEADAVMVLRLQKERMEAGLVQLEDYIAHYQVT
EARLGRAKPHAPLLHPGPMNRDVELEGHLADSPRSLVQRQVQNGVAVRMAVLYHVLVGRE
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggacgaggggcgaggtggaaaacctcctggac
accgccaaggtgatgcgggaggttttggagaggcccgtgaagaaggtccccgccctccag
ggcttcaccgtggccacagtcttctttgagccctccacccgcacccgcatctcctttgag
ctggcggcccggcgcatgtccgcggacgtggtctccttcaccgcggccacgagctccctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacatcctccgcgcggacagcgccggggtcccccaccaggccacccgctgggtgaagggg
gcggtggtgaacgccggcgacggccgccgggcccaccccacccaggccctcctggacgcc
tacacccttctggaggccttagggggcctggagggcaagaagatcgccatcgtgggggat
atcctccactcccgggtggcccgctccaacgcggagcttctgagcctcttgggggccgag
gtgtggtgcgcggggcccccaagcctcctcccccaggccctccccggggcccggctcacc
ccgcgtctggacgaggccttggaggaggcggacgcggtcatggtcttgaggctccaaaag
gagcggatggaggcggggcttgtccagctggaggactacattgcccactaccaggtgacg
gaggcccgcctagggagggccaagccccacgcccccctcctccaccccggccccatgaac
cgggacgtggagctggagggccacctggcggactccccgaggagcctggtccaaaggcag
gtgcaaaacggggtggcggtgcgcatggccgtgctctaccacgtgctggtggggagggag
ggttaa

DBGET integrated database retrieval system