KEGG   Thermus oshimai: Theos_0766Help
Entry
Theos_0766        CDS       T02346                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tos  Thermus oshimai
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theos_0766
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theos_0766
   00640 Propanoate metabolism
    Theos_0766
   00660 C5-Branched dibasic acid metabolism
    Theos_0766
Enzymes [BR:tos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Theos_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(705609..706745)
Genome map
AA seq 378 aa AA seqDB search
MNLHEYQAKEILARYGIPVPPGKVAYTPEEAKRIAEELGKRVVIKAQVHTGGRGKAGGVK
LADTPSEAYEKAQAILGMNIKGFTVKKVLVAEAVDIAKEYYAGLILDRAQKRVVLMLSKE
GGVDIEEVAAARPEAIHKFWIDPHKGFRPFEAREMVRKAGLEGNLNKLAQVLVNLYRAYE
GVDASIAEINPLVVTAEGQVVAADAKIVLDDNALFRHPDLAELREVEAEHPLEVEASNYG
FAYVKLSGNIGIIGNGAGLVMYTLDLVNRVGGRPANFLDIGGGAKADVVYNALKVVLKDP
DVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEEAKKLLEGKPVYMY
PTSVEAAKAIVAMVGGAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctgcacgagtatcaggccaaggagatcctagcccgctacggcatccccgtgccc
ccgggtaaggtggcctacacccccgaggaggccaagaggatcgcggaggagctgggcaaa
cgggtggtcatcaaggcccaggtccacacgggggggagaggaaaggcggggggggtcaag
ctggcggacacccccagcgaggcctacgagaaggcccaggccatcctggggatgaacatc
aagggcttcaccgtgaagaaggtcctggtggccgaggcggtggacatcgccaaggagtac
tacgccggcctcatcctggaccgagcccagaagcgggtggtcctgatgctctccaaggag
ggcggggtggacatcgaggaggtggccgcggcgcgccccgaggccatccacaagttctgg
attgacccccacaagggcttccgcccctttgaggcccgggagatggtgcggaaggcgggc
ctcgagggcaacctcaacaagctggcccaggtcctggtgaacctctaccgggcctacgag
ggggtggacgcctccatcgccgagatcaaccccctggtggtgaccgccgagggccaggtg
gtggccgcggacgccaagatcgtcctggacgacaacgccctcttccgccacccggacctc
gcggagctaagggaggtggaggcggagcaccccctggaggtggaggccagcaactacggc
ttcgcctacgtgaagctctccggcaacatcggcatcatcgggaacggggcggggctggtc
atgtacaccctggacctggtgaaccgggtggggggcaggcccgccaacttcctggacatc
gggggcggggccaaggcggacgtggtctacaacgccctcaaggtggtcctcaaggacccc
gacgtgaagggggtcttcatcaacatcttcggcggcatcacccgggcggacgaggtggcc
aagggggtcatccgcgccctggaggagggccttctcaccaagcccgtggtcatgcgggtg
gcgggcaccgcggaggaggaggccaagaagctcctggaaggcaagcccgtgtacatgtac
cccacatcggttgaggcggccaaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system