KEGG   Thermus oshimai: Theos_0766Help
Entry
Theos_0766        CDS       T02346                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tos  Thermus oshimai
Pathway
tos00020  Citrate cycle (TCA cycle)
tos00640  Propanoate metabolism
tos00660  C5-Branched dibasic acid metabolism
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01130  Biosynthesis of antibiotics
tos01200  Carbon metabolism
Module
tos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theos_0766
   00640 Propanoate metabolism
    Theos_0766
   00660 C5-Branched dibasic acid metabolism
    Theos_0766
Enzymes [BR:tos01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Theos_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A Succ_CoA_lig ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFV75826
UniProt: K7QUE5
Position
complement(705609..706745)
Genome map
AA seq 378 aa AA seqDB search
MNLHEYQAKEILARYGIPVPPGKVAYTPEEAKRIAEELGKRVVIKAQVHTGGRGKAGGVK
LADTPSEAYEKAQAILGMNIKGFTVKKVLVAEAVDIAKEYYAGLILDRAQKRVVLMLSKE
GGVDIEEVAAARPEAIHKFWIDPHKGFRPFEAREMVRKAGLEGNLNKLAQVLVNLYRAYE
GVDASIAEINPLVVTAEGQVVAADAKIVLDDNALFRHPDLAELREVEAEHPLEVEASNYG
FAYVKLSGNIGIIGNGAGLVMYTLDLVNRVGGRPANFLDIGGGAKADVVYNALKVVLKDP
DVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEEAKKLLEGKPVYMY
PTSVEAAKAIVAMVGGAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctgcacgagtatcaggccaaggagatcctagcccgctacggcatccccgtgccc
ccgggtaaggtggcctacacccccgaggaggccaagaggatcgcggaggagctgggcaaa
cgggtggtcatcaaggcccaggtccacacgggggggagaggaaaggcggggggggtcaag
ctggcggacacccccagcgaggcctacgagaaggcccaggccatcctggggatgaacatc
aagggcttcaccgtgaagaaggtcctggtggccgaggcggtggacatcgccaaggagtac
tacgccggcctcatcctggaccgagcccagaagcgggtggtcctgatgctctccaaggag
ggcggggtggacatcgaggaggtggccgcggcgcgccccgaggccatccacaagttctgg
attgacccccacaagggcttccgcccctttgaggcccgggagatggtgcggaaggcgggc
ctcgagggcaacctcaacaagctggcccaggtcctggtgaacctctaccgggcctacgag
ggggtggacgcctccatcgccgagatcaaccccctggtggtgaccgccgagggccaggtg
gtggccgcggacgccaagatcgtcctggacgacaacgccctcttccgccacccggacctc
gcggagctaagggaggtggaggcggagcaccccctggaggtggaggccagcaactacggc
ttcgcctacgtgaagctctccggcaacatcggcatcatcgggaacggggcggggctggtc
atgtacaccctggacctggtgaaccgggtggggggcaggcccgccaacttcctggacatc
gggggcggggccaaggcggacgtggtctacaacgccctcaaggtggtcctcaaggacccc
gacgtgaagggggtcttcatcaacatcttcggcggcatcacccgggcggacgaggtggcc
aagggggtcatccgcgccctggaggagggccttctcaccaagcccgtggtcatgcgggtg
gcgggcaccgcggaggaggaggccaagaagctcctggaaggcaagcccgtgtacatgtac
cccacatcggttgaggcggccaaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system