KEGG   Thermus oshimai: Theos_0837Help
Entry
Theos_0837        CDS       T02346                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tos  Thermus oshimai
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theos_0837
Enzymes [BR:tos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Theos_0837
Exosome [BR:tos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theos_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782898..784406
Genome map
AA seq 502 aa AA seqDB search
MYIGALDQGTTSTRFMVFDRQGREIARHQLEHRQIYPRPGWVEHDPLEIWARTQEAIQGA
LAKAGVRPGELAALGITNQRETTVVWNKNTGEPYHNAIVWQDTRTDAICEALKAEGLEEV
FRKKTGLPLSTYFSGPKLKWILDHVPGVREAAERGDALFGTVDTWLIWWLTGGPKGGRHV
TDVTNASRTLLMNLKTLDWDEELLALLGIPRAMLPEIRPSSDPNLYGTTDPDGPLGRAVP
VAGALGDQQAALVGQACFLPGEAKNTYGTGCFLLLNTGETPVESTRGLLTTVAYRFGEAP
AVYALEGSIAIAGALVQWLRDNLDFFDFSHHIEDYARTVEDSGGVYIVPAFSGLFAPYWD
PYARGTIVGLTRYATKGHLCRAALESVAYQTKDVLLAMEEDAGLPLSLLKVDGGMVKNEL
LMQFQADLLGVPVVRPQVTETTALGAAYAAGLAVGYWKDLEELKGNWRAERTFTPGMAEE
ERARLYAGWKRAVERSLGWARG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcggcgccttggaccagggcaccaccagcacccgcttcatggtctttgaccgc
caggggcgggagatcgcccggcaccagctggagcaccggcagatctaccccaggcccggc
tgggtggagcacgaccccctggagatctgggcccggacccaggaggccatccagggggct
ttggcgaaggcgggggtgcgcccaggagaactcgctgcccttggcatcaccaaccagcgg
gagaccaccgtcgtctggaacaagaacaccggggagccctatcacaacgccatcgtctgg
caggacacccgtacggacgccatctgcgaggccctgaaggcggaagggctggaggaggtc
ttccgcaagaagacgggccttcccctctccacctacttctccggccccaagctcaagtgg
atcctggaccacgtccccggggtgcgggaggcggcggagcggggggatgccctcttcggc
acggtggacacctggctcatctggtggcttactggggggcccaagggagggcggcacgtg
acggacgtgaccaacgccagccgcaccctgctcatgaacctcaagaccctggactgggac
gaggagctcctggccctcctcggcatcccccgggccatgctcccggagatccggccctcc
tcggaccccaacctctacgggaccaccgacccggatggccccctggggcgggcggtgccg
gtggcgggggcccttggggaccagcaggcggccctggtggggcaggcctgcttccttccg
ggagaggccaagaacacctacggcacggggtgcttcctcctcctgaacaccggggagacc
ccggtggagagcacgcggggcctcctcaccaccgtggcctaccggtttggggaggccccc
gcggtctacgccctggaggggtccatcgccatcgcgggggccttggtgcagtggcttagg
gacaacctagacttctttgacttctcccaccacatagaggactacgcccgcacggtggag
gatagcggcggggtgtacatcgtccccgccttctccggcctcttcgccccctactgggac
ccctacgcccgggggaccatcgtgggcctcacccgctacgccaccaagggccacctctgc
cgggcggccttggagagcgtggcctaccagacgaaggacgtgctcctggccatggaggag
gacgcggggcttccccttagcctcctcaaggtggatggggggatggtgaaaaacgagctc
ctcatgcagttccaggcggacctcctgggggtgccggtggtgcgcccccaggtgacggag
accaccgccctgggggcggcctacgccgcggggctcgccgtggggtactggaaggacctg
gaggagctaaaggggaactggcgggcggaacgcaccttcacccccgggatggcggaggag
gagcgggccaggctctacgcgggctggaagcgggcggtggagcggagcctggggtgggcc
agggggtag

DBGET integrated database retrieval system