KEGG   Thermus oshimai: Theos_1181Help
Entry
Theos_1181        CDS       T02346                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tos  Thermus oshimai
Pathway
tos00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01130  Biosynthesis of antibiotics
tos01230  Biosynthesis of amino acids
Module
tos_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theos_1181
Enzymes [BR:tos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Theos_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS RCDG1
Motif
Other DBs
NCBI-ProteinID: AFV76223
UniProt: K7QX20
Position
1132283..1133050
Genome map
AA seq 255 aa AA seqDB search
MRPDLKKVPGVLGEIARKRLAEVRPYPLPPPPPVPSFREALLGPGLSVIAEIKKKSPSQG
PIREVDPLEAALAYARGGAKALSVLTEPHWFGGSLEDLVRARGAGLPLLRKDFVVDPFML
EEARAFGASAALLIVALLGEETGAYLEEARRVGLDALVEVHTERELEVALEAGAEILGVN
NRDLHTLAIDLTTAPRLGRLARKRGFSGVLVAESGYRTGEELRALEGLFDAVLIGTNLME
AKDLEGALKGLLSGV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgaccttaagaaggtgcccggggtcctaggggagatcgcccggaaaaggctc
gccgaggtgcgcccctaccctctgccccctccgccccccgtaccctccttccgggaagcc
cttttgggccccggcctttccgtcatcgcggagatcaagaagaaaagcccctcccaaggg
cccatccgcgaggtggaccccctggaggccgccttggcctacgcccggggcggggccaag
gccctaagcgtcctcaccgagccccactggtttggggggagcctggaagacctggtgcgg
gcccggggggcgggccttcccctcctgcgcaaggacttcgtggtggatcccttcatgctg
gaggaggcccgggccttcggggccagcgccgcgcttctcatcgtggccctcctgggggaa
gaaacgggggcctacctggaagaggcgcggagggtgggcctggacgccctggtggaggtg
cacacggaacgggagctggaggtggccctcgaggccggggcggagatcctaggggtgaac
aaccgcgacctccacaccctcgccatagacctcaccaccgccccccgcctgggtcgcctg
gcccggaagcgggggttttccggggtcctggtggccgagtcgggctaccgcacgggggag
gagctaagggcgctggaggggctttttgacgcggtcctcatcggtacaaacctcatggaa
gcaaaggacctagaaggcgccttgaaggggcttctcagcggggtttag

DBGET integrated database retrieval system