KEGG   Thermus oshimai: Theos_1280Help
Entry
Theos_1280        CDS       T02346                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tos  Thermus oshimai
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Theos_1280
Enzymes [BR:tos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Theos_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1228037..1229539)
Genome map
AA seq 500 aa AA seqDB search
MELPRAYGLLLHPKSLPGPYGVGVLGEEARGFLRFLHRFGGRYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLVDLRPLEEAGYLRLEDPGFPQGRVDYGLLYRWKWPALRAAFQGFLEKAP
RSEWEAFEAFQEREGAWLRDYALFMALKARHGGLPWNAWPHPLRLREEAALRRAEGELAQ
EVAFHAWTQWLFFRQWGALKEEAEALGVELIGDMPIFVAEDSAEVWAHPGWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWDVLEREGFSFWVERLGKALELFHLVRIDHFRGFEA
YWEIPASCPTAVEGRWVKAPGERLFARIEEVFGRVPILAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDGGRENPFLPHNYPPHGRVVVYTGTHDNDTTLGWYRTATPHERAFLAQYLSE
WGLGFEREEEVPWALMALGMKSVARLAVFPVQDVLALGSEARMNYPGRPAGNWAWRLFPG
ALTEAHGARLLALAQDTGRV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccacgcgcctacggcctcctcctccaccccaagagcctccccggcccctac
ggggtgggggtgctgggggaggaggcccgggggtttctccgcttcctccaccgcttcggc
gggcgctattggcaggtcctccccctgggccccacgggctacggggactccccctaccag
tccttcagcgccttcgcggggaacccctacctcgtagaccttaggcctttggaggaggcg
ggctacctccgcctcgaggaccccggcttcccccaagggcgggtggactatggcctcctc
taccgctggaagtggcccgccctaagggcggccttccagggctttttggaaaaggcgcca
aggtcggagtgggaagcctttgaggccttccaggagcgggaaggggcctggcttagggac
tacgccctcttcatggccctaaaggcccggcacggggggcttccctggaacgcctggccc
cacccgttgcgcctcagggaggaggccgcgcttaggagggcggaaggggagctggcccag
gaggtggccttccacgcctggacccagtggctcttcttccgccagtggggcgccttgaag
gaggaggcggaggccttgggggtggagctcatcggggacatgcccatcttcgtggccgag
gactccgcggaggtctgggcccaccccggatggttccacctggacgaggagggccggccc
acggtggtggccggggtgcccccggattacttctcggaaacgggccagcgctggggcaac
cccctctaccgctgggacgtgctggagcgggaggggttttccttctgggtggagcgcctg
gggaaggccctagagcttttccacctggtgcgcatcgaccacttccgggggtttgaggcc
tactgggagatccccgcctcctgccccaccgcggtggaggggcggtgggtgaaggccccg
ggggagaggctcttcgcccgcatagaggaggtcttcggccgggtgcccatcctggcggag
gacctcggggtcatcacccccgaggtggaggccctaagggaccggttcggcctcccgggg
atgaaggtcctgcagttcgcctttgacggggggcgggagaaccccttcctcccccacaac
taccccccccacggccgggtggtggtctacaccggcacccacgacaacgacaccaccctg
ggctggtaccgcaccgccaccccccacgagcgggccttcctggcccagtacctttccgag
tggggtctgggctttgagagggaagaggaggtgccctgggccctcatggccttggggatg
aagtccgtggcccggcttgcggtcttccccgtgcaggacgtgctggccctgggctccgag
gcccggatgaactaccccgggcgccccgcgggcaactgggcctggcgccttttcccaggg
gccctcaccgaggcccacggggcgcggcttctcgccctggcccaagacacggggcgggtt
tag

DBGET integrated database retrieval system