KEGG   Thermus oshimai: Theos_1293Help
Entry
Theos_1293        CDS       T02346                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tos  Thermus oshimai
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tos00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tos00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242710..1243873)
Genome map
AA seq 387 aa AA seqDB search
MYEPKPEHKFTFGLWTVGNVGRDPFGDAVREKLDPVYVVHKLAELGVYGINLHDEDLIPR
GTPPAERDRIVRRFRKALEETGLKVPMVTANLFSDPAFKDGAFTSPDPWVRAYALRKSLE
TMDLGAELGAEIYVVWPGREGAEVEATGKSRRVWGWVREALNFMAAYAEDQGYGYRFALE
PKPNEPRGDIYFATVGSFLAFIYTLDQPERFGLNPEFAHETMAGLNFVHAVAQVLDAGKL
FHIDLNDQRMSRFDQDLRFGSENLKAAFFLVDLLESSGYQGPRHFDAHALRTEDEEGVWA
FARGCMRTYLIFKEKAQAFREDPEVRSLLEEYYGEDPQALGLLGPYSRERATALKEVALP
LEAKRRRGYALERLDQLVVEHLLGVRG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaacctaaaccggaacacaagttcacttttggtctatggactgtggggaacgtt
ggccgcgatccgtttggagacgcagttagggagaagctagaccctgtgtatgtggttcat
aaattggccgaacttggggtctatggaatcaaccttcacgacgaggacctgatccctagg
ggtacacctccggccgagcgggaccggatcgtgcggcgcttccgcaaggctttagaggaa
acagggttgaaggtgcccatggttaccgccaaccttttctcggatcccgccttcaaggac
ggcgcctttaccagccccgacccttgggtccgggcatatgctttgagaaagagcctggaa
accatggatttaggggccgagctaggtgcggaaatctacgtggtctggcccggaagggag
ggcgctgaggtggaggccacaggcaaatccagaagagtgtggggttgggtaagggaggcc
ctaaacttcatggccgcctatgcggaggatcagggttacggctatcgttttgccctcgag
cccaagcccaacgagcccaggggggatatctacttcgctaccgtggggagctttctggcc
tttatttacaccttagaccagcctgagcgcttcggtcttaatcccgagtttgcccacgag
accatggctggtttgaacttcgtccatgccgttgctcaagtccttgatgccggaaagctc
ttccacatagatctgaatgaccagcgcatgagtcgctttgaccaggacctccgctttggt
tcggagaacctcaaggcagccttctttttggtggatctcctcgagagctctggttaccag
ggtccgcgccactttgatgcccatgccctccgaacagaggacgaggagggggtctgggcc
tttgcccgtggatgcatgcggacctacctgatctttaaggagaaagcccaggctttccgg
gaagaccccgaggttcggtcccttttggaggagtattacggggaagatccccaggctttg
ggccttctgggtccttacagccgggagagagcaacagccctcaaagaggtggcgcttccc
ttggaagccaaacgccggcggggctatgccttagaacggctagatcagcttgttgtggag
caccttttaggggttcggggatga

DBGET integrated database retrieval system