KEGG   Thermus oshimai: Theos_1333Help
Entry
Theos_1333        CDS       T02346                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tos  Thermus oshimai
Pathway
tos00900  Terpenoid backbone biosynthesis
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01130  Biosynthesis of antibiotics
Module
tos_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theos_1333
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Theos_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Epimerase
Motif
Other DBs
NCBI-ProteinID: AFV76368
UniProt: K7QXB8
Position
1278078..1279181
Genome map
AA seq 367 aa AA seqDB search
MKRVVVLGSTGSIGRQALEVCRWRGYRVVGLAAGKNLEVLLPQIEEFQPLLVAADESLHA
ELKARFPGLRLGSPEEVAALEAEVAVAAIPGLAGLPPTRVAARTGKRIALANKEAMVTAG
PLLWQEVEAHGAEILPVDSEHSALFQALLGERREDVAELILTASGGPFLRGPEDLSQVTP
EMALAHPRWRMGPKVTVDSATLFNKGLEVLEAKELFRFPLEWIRVLVHPEAYVHGLVRFK
DGSLKAQLGPTDMRLPIQYALTHPERAETPLKDLPLPQTLTFLPPDTRRFPALEVAYEAG
RRGGVAQAAVSAADEVAVEAFLAGRIPFTAIPKVLAQVLEKVPNLPLTWENLFAVDAWAR
EEAKRWA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggtcgtggtcttggggtccacggggtccatcggccggcaggccctggaggtc
tgccgctggcggggctaccgggtggtgggcctggcggcgggaaagaacctggaagttctc
ctaccgcagatagaggagttccaaccccttctggtggccgcagacgaaagcctccacgcg
gagcttaaggcccgctttcccggtctgaggctgggtagccccgaggaggtggcggccctc
gaggcggaggtggcggtggccgccatcccgggcctggcggggcttccccccacccgcgtg
gccgcccggacggggaagcgcatcgccctggccaacaaggaggccatggtgaccgcgggg
ccccttctttggcaggaggtggaggcccacggggcggagatcctccccgtggactccgag
cactccgcccttttccaggcccttttaggggaaaggcgggaggacgtggccgagctcatc
ctcaccgcaagcggagggcctttcctaagggggccggaggacctttcccaggtcaccccg
gagatggccctggcccaccccaggtggcgcatgggccccaaggtcacggtggactccgcc
accctcttcaacaagggcctcgaggtcctggaggccaaggagctcttccgctttcccctg
gaatggatccgggtcctggtccaccccgaggcctacgtccacggcctggtgcgctttaag
gacggcagcctcaaggcccagctcgggcccacggacatgcgcctgcccatccagtacgcc
ctcacccacccagaacgggcggaaacccccctcaaggacctccccctcccgcaaaccctc
accttcctccccccggacacccggcgcttccccgccctggaggtggcctacgaggcgggc
aggcgggggggcgtggcccaggcggcggtctcggccgcggacgaggtggcggtggaggcc
ttcctcgcgggacggatccccttcaccgccatccccaaggtgctggcccaggtcctggaa
aaggtccccaaccttcccctaacatgggagaacctcttcgccgtggacgcctgggcccgg
gaagaggccaagaggtgggcatga

DBGET integrated database retrieval system