KEGG   Thermus oshimai: Theos_1370Help
Entry
Theos_1370        CDS       T02346                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tos  Thermus oshimai
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Theos_1370
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Theos_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315108..1316466
Genome map
AA seq 452 aa AA seqDB search
MAQVVVVGGGWAGLSAALALKEAGAEVLLLEGNLRLGGKVRTHRQEGFLLEGGPDASVRY
KKEVLELGERFGLEPVGTLPAKPSAYILKGGKAHPLPEGLLQVVPGDLRALAKTPLLSFS
GKLRALLDLLLPRGGAPDEGLKAFVERRLGPEVYRALVAPLSGGIYGGEPDELSMRAAFP
QLLELERKHRSLILGAMRARKARGSREGGSLFFSFREGLSALTRKMAEALSESVLLGTPA
LGLEAQGSRYRVHTPRGFLEAEAVVLATPAPQAAALLRPFLPEATALLKGIPHTPAATVS
LAFAEALPLSGHGLLIAKGEGYRVRGFTWTHQKWPERAPEGFSLVRAYLSGEEARLGEAE
LIRLALEDLARFLGFTPKVHRAWAFRFPEGMPAYRVGHLERIERLEMALLKAPGVFLAGN
YLEGVGLPEVVRSGRKAAARAVAYLALEKAPG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaggtcgtagtggtgggcgggggctgggcggggctttccgccgccctcgccctc
aaggaggccggggcggaggtcctcctcctggaagggaacttaaggcttgggggcaaagtg
cgcacccaccgccaggagggctttctcctggagggggggccggacgccagcgtgcgctac
aagaaggaggtcttggagcttggggagcggtttggcctggagcccgtggggaccctcccc
gccaagccctcggcctacatcctcaaagggggcaaggcccaccccctgcccgagggcctt
ctccaggtggtgccgggggacctgagggccctggccaaaacccctctcctctccttctcg
gggaagcttagggccctcttagacctcctcctcccccggggtggcgccccggacgagggc
ctgaaggccttcgtggaacggcggcttgggcccgaggtctaccgggccctggtggccccc
ttgagcggggggatctacgggggggagcccgacgagctttccatgcgggcggccttcccc
cagcttttggagctggagcggaagcaccggagcctcatcctgggggccatgcgggccagg
aaggcccgggggagccgggaggggggaagcctcttcttctccttccgggaagggctttcc
gccctcacccgcaagatggcggaggccctttcggaaagcgtcctcctcggcaccccggcc
ctaggcctcgaggcccagggaagccgctaccgggtccacaccccaaggggcttcctggag
gcggaggcggtggtcctggccaccccggccccccaggcggccgcgctcttaaggcccttc
ctccccgaggccaccgccctcttaaagggcatcccccacacccccgcggccacggtgagc
ctggccttcgccgaggcgcttcccctttccggccacggcctcctcatcgccaagggggag
gggtacagggtgcggggcttcacctggacccaccagaagtggccggaaagggccccggaa
ggcttcagcctggtgcgggcctacctctcgggggaggaggcccgcctgggcgaggccgag
ctcatccgcctggccctggaggacctcgcccgcttccttggctttacgcccaaggtccac
cgggcctgggccttccgcttccccgaggggatgcccgcctaccgggtggggcacctggag
cggattgagcggctggagatggccctcctcaaggcccccggggtgttcctagcggggaac
tacctggagggggtgggcctccccgaggtggtgcgctccggcaggaaggcggccgccagg
gccgtggcgtatctggccttggaaaaggccccgggctag

DBGET integrated database retrieval system