KEGG   Thermus oshimai: Theos_1717Help
Entry
Theos_1717        CDS       T02346                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tos  Thermus oshimai
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tos00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tos00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1653242..1654702
Genome map
AA seq 486 aa AA seqDB search
MTLKELFAPFGLEAPPLPVRGLTLDSRRVEEGYVFVAVPGVPLPHRKPLDGHDFIEEALR
RGAIAVVGERPLALPVPYLRVEDGRKALAALSARFHGHPERALPLLGVTGSKGKSTTSAL
LHHLLERGGIPSALLSTVGLRLGEEERAPIGHFTTPEAPEVYGFLREALDRGLKAAVLEV
SSHALALKRVEGLSYRVGVFVSFYPDDHLDLHGTPEAYFRAKALLVERSGLAVLNARLPH
LEAFKARPHLLFGEGGEVRGEGLKETPEGLRFRLETPWGGGEAFLPLLGAYNLENALAAS
AAALAFGVGLGAVLEGLSSFKGVRGRMEVVQRAPFRVVIDFAHTGKSLEEALKTLRKTTK
GRLLLVVGAAGERDPNRRRDIGRVAARFADKTFFTEEDHRTEPLEAILEALARSAREEGG
VFELVPDRKEAIFRAIREARPGDTVLLAGKGHESTLERGPLALPWDERKVALEALGADQD
ALEGDP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaaggagctcttcgcccccttcggcctagaggccccgcccctccccgtgcgg
gggcttaccctggactcgaggcgggtggaggaaggctacgtcttcgtggccgtccctggg
gtgcccctgccccaccggaagcccctggacgggcacgacttcatagaagaggccctccgc
cggggggccatcgccgtggtgggggaaaggcccctcgccctccccgtcccctacctccgg
gtggaggatggccgcaaggccctggcggcgctttccgcccgctttcatggccacccggag
cgggcccttcccctcctcggggtcacggggtccaaggggaagagcaccacctcggccctc
ctccaccacctcctggaacgggggggcatcccttccgccctcctctccaccgtgggcctc
cgcctgggggaagaggagcgagcccccatcggccacttcaccacccccgaggcccccgag
gtctacggcttcctgcgggaggccctggaccgggggctgaaggcggccgtgctggaggtc
tccagccacgccctggccttgaagcgggtggaggggctttcctaccgggtgggggtcttc
gtgagcttctaccccgacgaccacctggacctccacggcaccccggaggcctacttccgg
gccaaggcccttctggtggagcgctcagggctcgccgtgctgaacgccaggctcccccac
ctggaggcctttaaagcacggccccacctcctcttcggcgaggggggggaggtgcggggg
gagggcctaaaggagacgccggaggggcttcgcttccgtctggaaaccccttggggcggg
ggggaggcctttttgcccctccttggggcctacaacctggaaaacgccctggcggcctcc
gccgccgccctcgccttcggggtggggcttggggcggtgctggaggggctttccagcttc
aagggggtcagggggcggatggaggtggtgcaaagggcgcccttccgggtggtcattgac
ttcgcccacaccgggaaaagcctggaggaggccctgaaaaccttgcgcaagaccacaaag
ggccgcctcctcctggtggtgggggccgcgggggaaagggacccgaaccgccggcgggac
atcgggcgggtggccgctaggtttgcggacaagaccttcttcaccgaggaggaccaccgc
acggagcccctggaggccatcctcgaggccctggcccgctcggcccgggaggaggggggg
gtctttgagctggtgccggaccgcaaggaggccatcttccgggccatccgggaggcccgg
cccggggacacggtgctcctcgcgggcaaggggcacgaaagcaccctggaaaggggcccc
ctcgccctgccttgggacgagcgcaaggtggccctggaggccctaggggcggaccaggat
gccctcgagggcgatccttag

DBGET integrated database retrieval system