KEGG   Thermus oshimai: Theos_1801Help
Entry
Theos_1801        CDS       T02346                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tos  Thermus oshimai
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theos_1801
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theos_1801
   00630 Glyoxylate and dicarboxylate metabolism
    Theos_1801
Enzymes [BR:tos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Theos_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728826..1730388
Genome map
AA seq 520 aa AA seqDB search
MKGVEIRKDHPLLGEVLTEEALRFVVALHREFNPVRKGLLARRQELWARYKAGERPDFLE
STRFVRGGSWRVAEAPEDLQDRRVEITGPVERKMIVNALNSGAKVFMADFEDALSPTWDN
VIRGQKNLMDAVRRQIDFVSPEGKEYRLKEKVATLVVRPRGWHLHEKHVYVDGEPISASL
FDFGLYFFHNAHELLKRGSGPYFYLPKLESHLEARLWNEVFNFAQDYLGLPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHLHEAHAIGGMAAFIPSRKDPEVNERALKQVRADKEREAGQGFDGTWVAH
PDLVPVAMEVFDRFLGDKPHQKHVKREDVRVGAEDLLDFQVPGGKVTEAGFRNNVSVALQ
YLNQWLLGNGAAAIFNLMEDAATAEIARAQLWQWVHRGATLEDGRPVTPELYQKVKEEEL
QKLGGREAGRYREAEEILDKLVLSEEFIEFLTLVAYEYID
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggagatcaggaaggaccaccccctcttaggggaggtgctcacggaagag
gcccttaggttcgtggtggccctgcaccgggagttcaaccccgtgcgcaaaggcctcctg
gcccgccggcaggagctttgggcgcgctacaaagcgggggagaggccggacttcctggag
tccacccgcttcgtgcgggggggaagctggcgggtggccgaggccccggaggacctacag
gaccgccgggtggagatcacgggccccgtggagcggaagatgatcgtgaacgccctaaac
tccggggccaaggtcttcatggcggactttgaggacgccctctcccccacctgggacaac
gtcatccgcgggcagaagaacctcatggacgcggtgcgccgccaaatagacttcgtctcc
cccgaggggaaggagtacaggctcaaggaaaaggtggccaccctggtggtgcgcccaagg
ggctggcacctgcatgaaaagcacgtctacgtggacggggagcccatctccgccagcctc
tttgacttcggcctctacttcttccacaacgcccacgagctcctaaagcgggggagcggg
ccctacttctacctgcccaagctggagagccacctggaggcccggctttggaacgaggtc
ttcaacttcgcccaggactacctgggcctcccccgggggacgatccgggccacggtcctc
atcgagaccatcctggcggcctttgagatggaggagatcctctacgagcttaaggagcac
gccgccgggctcaacgccggccgctgggactacatcttcagctgcatcaagaagttcgcc
accactgcccccatcttccccgaccgggcccaggtcaccatgaccgtgcccttcatgaag
gcctacaccgagcttctggtgaagagctgccacctccacgaggcccacgccatcgggggg
atggcggccttcatcccgagccgcaaggaccccgaggtgaacgagcgggccttaaagcag
gtgcgggccgacaaggaaagggaggcgggccaggggtttgacggcacctgggtggcccac
cccgacctggtgccggtggccatggaggtctttgaccgcttcctgggggataagccccac
cagaagcatgtgaagcgggaggacgtaagggtgggggcggaggacctcctggacttccag
gtccccggggggaaggtgacggaagcgggctttaggaacaacgtctccgtggccctccag
tacctgaaccagtggcttctcggcaacggggccgcggccatcttcaacctcatggaggac
gcggccacggcggagatcgcaagggcccagctctggcagtgggtccaccggggggccacc
ctggaggacggccgcccggtgacgcccgagctctaccagaaggtgaaggaggaggagctc
caaaagcttgggggccgggaggcgggccggtatagggaggccgaagagatcctggacaag
ctggtcctttcggaagagttcattgagttcctcaccctggtggcctacgagtacatcgac
tga

DBGET integrated database retrieval system