KEGG   Thermus oshimai: Theos_1802Help
Entry
Theos_1802        CDS       T02346                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tos  Thermus oshimai
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1730388..1731080
Genome map
AA seq 230 aa AA seqDB search
MAGVLLLHGLSSHPVLTLGPLPGALREAGYTVAQPALPGHGTRPEDLRGVGWRDWYGKAL
EAYRALPEPKGVVGLSMGALLAAMLAAEEGASFLVALAPALVLRNPLAGLAPYLHPLIPK
APRTRSVSDAKRRRASPNYPWIPTSAVAELVRLQKAVDPLLPKVQAPALVVQALWDTTLS
PKGVKRFYERLGSERKDLVAYESEHDLLLDLKAEEVARDVALWIRGVLPP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtcctcctcctccacgggctttcctcccaccccgtcctcaccctggggccc
ctgcccggggcgctccgggaagcggggtacaccgtggcccagcccgccctgcccggccac
gggacccggcccgaggaccttaggggggtgggctggagggactggtacgggaaggccctg
gaggcctaccgcgccctccccgagcccaaaggggtggtggggctttccatgggggccctc
ctcgccgccatgctcgcggcggaggagggggcctccttcctggtggccctggccccggcc
ctggtcctgaggaaccccctggcgggcctcgccccctacctccaccccctcatccccaag
gccccccgcacccgctccgtctccgacgcaaaaaggcggcgggcaagccctaactacccc
tggatccccacctccgcggtggcggagctcgtaaggctccagaaggcggtggaccccctt
ctccccaaggtgcaggcccccgccttagtggtccaggccctctgggacaccaccctttcc
cccaagggggtaaagcgcttttacgagcgcttggggagcgaaagaaaagacctggtcgct
tatgagagcgagcacgacctcctcctggacctcaaggcggaggaggtggcgcgggacgtg
gccttatggatccggggggttctccccccttag

DBGET integrated database retrieval system