KEGG   Thermus oshimai: Theos_1818Help
Entry
Theos_1818        CDS       T02346                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tos  Thermus oshimai
Pathway
tos00260  Glycine, serine and threonine metabolism
tos00750  Vitamin B6 metabolism
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01230  Biosynthesis of amino acids
Module
tos_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theos_1818
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theos_1818
Enzymes [BR:tos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theos_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFV76835
UniProt: K7R0P1
Position
complement(1741341..1742396)
Genome map
AA seq 351 aa AA seqDB search
MRLPLIERYRAHLPVSLNTPVVSLLEGSTPLIPLKGPKEARERGIRLYAKFEGLNPTGSF
KDRGMTLAVSKAVEAGAQAVACASTGNTAASAAAYAARAGVLSLVILPAGYVALGKVAQS
LVHGARIVQVEGNFDQALRLTRELTERYPVALVNSLNPYRLEGQKTLAFEVVDELGEAPH
YHALPVGNAGNITAHWMGYKEYHALGKAKGLPRMLGFQAAGAAPLVLGRPVERPETLATA
IRIGNPASWEGALRAKEESGGLIEAVTDGEILEAYRYLAREEGIFCEPASAAALAGVWKL
LREGRLEEGSTVVLTLTGHGLKDPATAEKVAELPPPVPPDLEAVARAAGLS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccctcatagagcgctaccgcgcccacctgcccgtctccctgaacaccccc
gtggtctcccttctggagggctccacccccctcatccccctgaagggccctaaggaggcc
agggagcggggtatacggctttacgccaagtttgagggcctgaaccccacggggagcttc
aaggaccgggggatgaccctggcggtgtccaaggcggtggaggcgggggcccaggcggtg
gcctgcgccagcacggggaacaccgcggcctcggccgcggcctacgccgcccgggcgggg
gtcctctccctggtcatcctccccgcggggtacgtggccttgggcaaggtggcccaaagc
ctggtgcacggggcccgcatcgtccaggtggaggggaactttgaccaggccctccgcctc
acccgggagctcacggagcgctaccccgtggccctggtgaactccctaaacccctaccgc
ctggaagggcagaagaccctggcctttgaggtggtggacgagctgggggaggccccccac
taccacgccctccccgtgggcaacgcggggaacatcaccgcccactggatggggtacaag
gagtaccacgccctggggaaggccaaggggcttcccaggatgctgggcttccaggcggcg
ggggcggcccccctggttctggggcggcctgtggagaggcccgagaccctggccaccgcc
atccgcatcggcaaccccgcaagctgggaaggggcccttagggccaaggaggagtccgga
ggcctgattgaggcggtgacggacggggagatcctggaggcctaccgctacctggcccgg
gaggaggggatcttctgcgagcccgcaagcgccgccgccctcgcgggggtctggaagctc
ctgagggaagggcggctggaggaggggagcacggtggtcctcacccttaccggccacggc
ctcaaggacccggccaccgcggagaaggtggccgagctacccccccctgtgcccccggac
ctcgaggcggtggcccgggccgcggggctttcgtga

DBGET integrated database retrieval system