KEGG   Thermus oshimai: Theos_2026Help
Entry
Theos_2026        CDS       T02346                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tos  Thermus oshimai
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tos03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1914617..1915408
Genome map
AA seq 263 aa AA seqDB search
MPELPEVETTRRKLLPLLRGKALLKILHQDPLRYRNTGEAEGKRVLDLERRGKFLLFALT
EGKEMVVHLGMTGGFRKEKTPHARVEFVLEDGHLFFHDPRRFGRIWVVERGAYGEIPLLA
RLGPEPLGAFPFPPFYKALKGSRKPLKALFLEQRLAAGVGNIYADEALFRAGLNPLRPGQ
SLSEAEAFRLHQALRSVLEEAVALGGSTLSDKTYQQPDGVPGGFQARHAVYGRKGLPCPR
CGGPILRLRVAGRGTHFCPRCQA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctccccgaggtggagaccacccgcagaaagctccttcccctcctccgggga
aaggccctcctcaagatcctccaccaagaccccttacgctaccggaacacaggagaagcg
gaagggaaaagggtgttggacttggagcgccgggggaagttcctcctcttcgccctcacg
gaggggaaggagatggtggtccacctgggcatgaccgggggcttccgcaaggagaagacc
ccccacgcccgggtggagttcgtcctggaggacgggcacctcttcttccacgacccccgg
cgcttcgggcgcatctgggtggtggagcggggggcgtacggggaaatccccctcctcgcc
cgcctgggccccgagcccctgggggccttcccctttccgcccttctacaaggcccttaag
gggagccggaagcccctcaaggccctcttcctggagcagcgcctagccgcgggggtgggg
aacatctacgcggacgaggcccttttccgcgcggggctaaaccccttgcgcccggggcaa
agcctctcggaggcggaggccttccgcctgcaccaggccctgaggagcgtcctggaagag
gcggtggccctaggggggagcaccctttccgacaagacctaccagcagccggatggcgtc
cccgggggcttccaggcccggcacgcggtctacgggcggaagggcctcccctgcccccgc
tgcggcggccccatcctccgcctccgggtggccgggcggggcacccacttctgcccccgc
tgccaggcgtag

DBGET integrated database retrieval system