KEGG   Thermus oshimai: Theos_2026Help
Entry
Theos_2026        CDS       T02346                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tos  Thermus oshimai
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tos00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Theos_2026
Enzymes [BR:tos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Theos_2026
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Theos_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1914617..1915408
Genome map
AA seq 263 aa AA seqDB search
MPELPEVETTRRKLLPLLRGKALLKILHQDPLRYRNTGEAEGKRVLDLERRGKFLLFALT
EGKEMVVHLGMTGGFRKEKTPHARVEFVLEDGHLFFHDPRRFGRIWVVERGAYGEIPLLA
RLGPEPLGAFPFPPFYKALKGSRKPLKALFLEQRLAAGVGNIYADEALFRAGLNPLRPGQ
SLSEAEAFRLHQALRSVLEEAVALGGSTLSDKTYQQPDGVPGGFQARHAVYGRKGLPCPR
CGGPILRLRVAGRGTHFCPRCQA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctccccgaggtggagaccacccgcagaaagctccttcccctcctccgggga
aaggccctcctcaagatcctccaccaagaccccttacgctaccggaacacaggagaagcg
gaagggaaaagggtgttggacttggagcgccgggggaagttcctcctcttcgccctcacg
gaggggaaggagatggtggtccacctgggcatgaccgggggcttccgcaaggagaagacc
ccccacgcccgggtggagttcgtcctggaggacgggcacctcttcttccacgacccccgg
cgcttcgggcgcatctgggtggtggagcggggggcgtacggggaaatccccctcctcgcc
cgcctgggccccgagcccctgggggccttcccctttccgcccttctacaaggcccttaag
gggagccggaagcccctcaaggccctcttcctggagcagcgcctagccgcgggggtgggg
aacatctacgcggacgaggcccttttccgcgcggggctaaaccccttgcgcccggggcaa
agcctctcggaggcggaggccttccgcctgcaccaggccctgaggagcgtcctggaagag
gcggtggccctaggggggagcaccctttccgacaagacctaccagcagccggatggcgtc
cccgggggcttccaggcccggcacgcggtctacgggcggaagggcctcccctgcccccgc
tgcggcggccccatcctccgcctccgggtggccgggcggggcacccacttctgcccccgc
tgccaggcgtag

DBGET integrated database retrieval system