KEGG   Thermus oshimai: Theos_2027Help
Entry
Theos_2027        CDS       T02346                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tos  Thermus oshimai
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tos00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1915419..1915898
Genome map
AA seq 159 aa AA seqDB search
MRAYIALGSNLGDRTGYLLLALSALSRLPKTHLLRLSPVYETDPVGPPQPLYLNLVAEVE
TALPPKALLQHLLDIEQALGRVRTEPLGPRTIDLDLLLYGDLVLEEEGLTLPHPRLQERA
FVLVPLADLAPDLVHPRLGQRVADLLKRVEGKGVRPLVL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcctacatcgccttggggagcaacctgggggaccgcaccggctacctcctcctg
gccctttccgccctctcccgcctgcccaagacccacctcctccgcctctcccccgtctac
gagaccgaccccgtaggccccccccagcccctctacctcaacctggtggcggaggtggag
accgccctcccccccaaggccctcctccagcatctcctggacatagagcaggccctgggc
cgggtccggaccgagcccctgggccccaggaccatagacctggacctcctcctctacggg
gacctggtcctggaggaggagggccttaccctcccccacccccgcctccaggagcgggcc
ttcgtcctggtaccccttgcggacctggcccccgacctggtccatccccggctgggccag
cgggtggccgacctcctgaagagggtggaggggaagggggtgcgcccccttgtgctatag

DBGET integrated database retrieval system