KEGG   Thermus oshimai: Theos_2299Help
Entry
Theos_2299        CDS       T02346                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tos  Thermus oshimai
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Theos_2299
Enzymes [BR:tos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Theos_2299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHEOS01:103317..104081
Genome map
AA seq 254 aa AA seqDB search
MRIAYAGLRRKEEFKALAEKLGFTPLLLPVQATERVPVPEYTEALEALARGVDLFLATTG
VGVKDLLQAGEALGLDLKRPLQQAHRLARGEKAARALRALGLPPHATGDGTSPSLLPLLP
EGPGRAALQLYGKPLPLLERALEERGFQVLPLLPYRHLPDLEGLRRLEEAVLRGEVEAVA
FVAALQVEFLFEGARDPEALREALNTRVLPLAVGRVTADALREWGVERFFVSETERLGAM
LQAFRKEAVWATSP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgcctacgcggggctccgcaggaaggaggagttcaaggccctggcggaaaag
ctcggcttcaccccccttctccttcccgtccaggccacggaaagggtccccgtgcccgag
tacacagaggccctggaggcgctggcccggggcgtggacctcttcctcgccaccacgggg
gtgggggttaaggacctcctccaggccggggaggccctggggctggacctcaagcgacct
ctccagcaggcccaccgcctggcccggggggagaaggccgcccgcgccctaagggccctg
ggccttcccccccacgccaccggggacgggacctccccaagcctcctccccctcctccca
gaagggcctggccgggccgccctccagctctacggcaagcccctgcccctcctggaacgg
gccctggaagagcggggcttccaggtgcttcccctcctcccctaccgccacctcccggac
ctcgagggcctccggcggctggaggaggccgtcctccggggggaggtggaggccgtggcc
ttcgtggccgccctccaggtggagttcctctttgagggggcaagggacccggaagccctc
cgggaggccctcaacacccgcgtcctccccctggccgtgggccgggtcaccgccgacgcc
ttaagggaatggggggtggagcgctttttcgtctcggaaacggagcggcttggggccatg
ctccaggccttccgcaaggaggccgtatgggctacttccccttga

DBGET integrated database retrieval system