KEGG   Thermus oshimai: Theos_2341Help
Entry
Theos_2341        CDS       T02346                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tos  Thermus oshimai
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theos_2341
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Theos_2341
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Theos_2341
Enzymes [BR:tos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Theos_2341
Exosome [BR:tos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theos_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHEOS01:140635..142134
Genome map
AA seq 499 aa AA seqDB search
MNRRDLLKAGLVIGAASGLARAQGGMTPFLPKARNLIVMVYDGFSWEDFAIARAYAQRVL
GRKLTLERLFGQGAFGQIHTNSLTSYVTESSAAGNAFSCGVKTVNGGLAVHADGTKLLPI
FAAAKEAGKAVGLVTTTTVTHATPASFVVSNPDRNAEEAIAEQYLAFGAEVYLGGGDRFF
SAERRSDKKDLYALFREKGYGVVRTLEELQAERSNRLLGIFSSSHVPYEVDRRFQGVKVP
SLKEMTEAALKRLPTYRQGFVLQVEAGRIDHANHLNDPAATLWDVLAADEALELLMGFVD
RYPDTLLIVVSDHATGVGALYGAGRSYLESSLGIDLLKDQKASLEFMLARLGQNPDAAQV
KEAFRAMKGVALKDEEAAMVVEAIAKKAYRPDGVRYGVQPANTLSWAMVQREAARPDRPN
IGWSSGQHTASPVMLALYGAGVGRGVRLGLLDNTDVFTIMSQALGLRYQNPVMTEEEALE
VLAKRPGAEWVHPKETLAV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtagggatctcctcaaggcaggactggtcataggggccgcctcggggctggcc
cgggcccagggggggatgacgcccttcttgcccaaggcgcggaacctcatcgtcatggtc
tacgacggcttctcctgggaggacttcgccatcgcccgggcctacgcccagcgggttctg
ggccggaagctcaccctggagcgcctcttcgggcagggggccttcggccagatccacacc
aacagcctcacctcctacgtcaccgagtccagcgccgcggggaacgccttctcctgcggg
gtgaagacggtgaacggggggctggcggtgcacgcagacgggaccaagctcctccccatc
ttcgccgcggccaaggaggcgggcaaggcggtgggcctggtgaccaccaccacggtgacc
cacgccacccccgcctccttcgtggtgagcaaccccgaccgcaacgcggaggaggccatc
gcggagcagtacctggccttcggggcggaggtctacctggggggtggggaccggttcttc
agcgcggagaggcggagcgacaaaaaggacctctacgccctcttccgggaaaagggctac
ggggtggtgcgcaccctcgaggaactccaggcggagcgctccaaccgcctcctggggatc
ttctccagcagccacgtgccctacgaggtggaccgccgcttccagggggtgaaggtcccc
tccctgaaggagatgaccgaggccgccctcaagcgccttcccacctaccggcagggcttt
gtcctccaggtggaggccgggcggatcgaccacgccaaccacctcaacgaccccgcggcc
accctttgggacgtgctggccgcggacgaggccctggaactcctcatgggcttcgtggac
cgctaccccgacacccttctcatcgtggtctccgaccacgccaccggggtgggggccctc
tacggagctggccggtcctacctggaaagcagcctgggcatagacctcctcaaggatcag
aaggcttccttggagttcatgttggcgcgcctgggccagaaccccgacgccgcccaggtg
aaggaggccttccgcgccatgaagggggtggccctcaaggacgaggaggcggccatggtg
gtggaggccatcgccaagaaggcctaccggcccgacggggtgcgctacggcgtccagccc
gccaacaccctctcctgggccatggtgcagcgggaagccgcccgacccgaccggcccaac
atcggctggagctccgggcagcacaccgcaagcccggtcatgctggccctctacggggct
ggggtggggcggggggtgcggctgggcctcctggacaacaccgacgtgttcaccatcatg
agccaggctttgggcctgcgctaccaaaacccggtgatgacggaggaggaggccctggag
gtcctagccaagcgccccggggcggagtgggtgcaccccaaggagaccctggcggtgtag

DBGET integrated database retrieval system