KEGG   Thermus oshimai: Theos_2435Help
Entry
Theos_2435        CDS       T02346                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tos  Thermus oshimai
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Theos_2435
  Lipid metabolism
   00561 Glycerolipid metabolism
    Theos_2435
   00600 Sphingolipid metabolism
    Theos_2435
Enzymes [BR:tos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Theos_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHEOS01:230058..231326
Genome map
AA seq 422 aa AA seqDB search
MIRIAFVGAGNAVFGRTFLLDLFLSPLEEVEVRLVDPEGDRLARLVRLGEKFREEGPKAV
YLRPLPLPEALRGAHVLVFAADVGGEEVLRQDYETALAFGVDQSIGDTLGPGGLMKFLRL
LPLLEEVAEGFQGELILNYANPLTAVTAFLARKGHRALGLCHSIAETARTLAGYLGFSEG
ELDYLAGGVNHLSWFVRLAHGGEDLYPRLRALAQQEDYWELDPVRFELLRVFGLFPSESS
GHVSEYLPYFRKRPEIMARYVRSGYRGESGFYPRHHLRFVEEALREEEAWLRGAYPKSPS
GEYAVPVLEAFFLGRAFRLYATHLETRVPGLLAGFPAEAPLRLPAWKGEEVLLPPGPLAL
SRHAQEVQALWVEGALGHDPSLLLQGLALDPLTAAVLDLRGIEALFRRLVEAGKGLLPSW
VT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcgcgtttgtgggcgccggcaatgcggtttttggccgcacctttctctta
gacctcttcctctcccccttggaggaggtggaggtgcgcctggtggaccccgaaggggac
cgcctagcccggctggtgcgcttgggagagaagttccgggaagaggggcccaaagccgtt
tacctccgccctctgcccctgccggaggccctgaggggagcccacgtcctggtcttcgct
gcggatgtggggggagaggaggtcctgaggcaggactacgagacggcgttggcctttggg
gtggaccagtctatcggcgataccctgggcccgggggggctcatgaagttcctccgcctg
ctccccctcctggaggaggtggcggaagggtttcagggagagcttatcctgaactacgcc
aaccccctgaccgccgtgaccgcctttttggcgcggaaagggcatagggcgctgggcctt
tgccactccattgccgaaaccgcccgtaccctggcgggctacctgggcttttcggaaggg
gagctggactacctggcgggaggggttaaccatctttcctggtttgtccgcctagcccat
gggggggaggacctttacccccgcctccgggccctggcccagcaggaggattactgggag
ctggacccggtgcggtttgagctcttgcgcgtctttggcctcttcccttcggagtccagc
ggacacgtttccgaatacctgccctacttccgcaagcggccggagatcatggcccgctat
gtccgttccgggtataggggagagagcgggttttacccccgccaccacctccgctttgtg
gaggaggccctgcgggaggaggaggcttggcttcgcggcgcctacccaaaatcccccagc
ggggagtatgcggtaccggtgttggaggccttcttcttggggagggcgttccgcctttac
gctacccacctcgagacccgggtccctgggctcctggccggttttcccgcggaggccccc
ttgcgcctccccgcctggaagggggaggaggtcctcctccccccgggtcccctggcccta
agccggcatgctcaggaggttcaggccctttgggtggagggggctctagggcatgacccc
agccttctccttcagggcctggccttggatcccctcacggcggcggtgctggacctcagg
ggaatagaggccctctttcgcaggctggtagaggccggaaagggccttctcccttcttgg
gtaacgtag

DBGET integrated database retrieval system