KEGG   Thermus oshimai: Theos_2435Help
Entry
Theos_2435        CDS       T02346                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tos  Thermus oshimai
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tos00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tos00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHEOS01:230058..231326
Genome map
AA seq 422 aa AA seqDB search
MIRIAFVGAGNAVFGRTFLLDLFLSPLEEVEVRLVDPEGDRLARLVRLGEKFREEGPKAV
YLRPLPLPEALRGAHVLVFAADVGGEEVLRQDYETALAFGVDQSIGDTLGPGGLMKFLRL
LPLLEEVAEGFQGELILNYANPLTAVTAFLARKGHRALGLCHSIAETARTLAGYLGFSEG
ELDYLAGGVNHLSWFVRLAHGGEDLYPRLRALAQQEDYWELDPVRFELLRVFGLFPSESS
GHVSEYLPYFRKRPEIMARYVRSGYRGESGFYPRHHLRFVEEALREEEAWLRGAYPKSPS
GEYAVPVLEAFFLGRAFRLYATHLETRVPGLLAGFPAEAPLRLPAWKGEEVLLPPGPLAL
SRHAQEVQALWVEGALGHDPSLLLQGLALDPLTAAVLDLRGIEALFRRLVEAGKGLLPSW
VT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatcgcgtttgtgggcgccggcaatgcggtttttggccgcacctttctctta
gacctcttcctctcccccttggaggaggtggaggtgcgcctggtggaccccgaaggggac
cgcctagcccggctggtgcgcttgggagagaagttccgggaagaggggcccaaagccgtt
tacctccgccctctgcccctgccggaggccctgaggggagcccacgtcctggtcttcgct
gcggatgtggggggagaggaggtcctgaggcaggactacgagacggcgttggcctttggg
gtggaccagtctatcggcgataccctgggcccgggggggctcatgaagttcctccgcctg
ctccccctcctggaggaggtggcggaagggtttcagggagagcttatcctgaactacgcc
aaccccctgaccgccgtgaccgcctttttggcgcggaaagggcatagggcgctgggcctt
tgccactccattgccgaaaccgcccgtaccctggcgggctacctgggcttttcggaaggg
gagctggactacctggcgggaggggttaaccatctttcctggtttgtccgcctagcccat
gggggggaggacctttacccccgcctccgggccctggcccagcaggaggattactgggag
ctggacccggtgcggtttgagctcttgcgcgtctttggcctcttcccttcggagtccagc
ggacacgtttccgaatacctgccctacttccgcaagcggccggagatcatggcccgctat
gtccgttccgggtataggggagagagcgggttttacccccgccaccacctccgctttgtg
gaggaggccctgcgggaggaggaggcttggcttcgcggcgcctacccaaaatcccccagc
ggggagtatgcggtaccggtgttggaggccttcttcttggggagggcgttccgcctttac
gctacccacctcgagacccgggtccctgggctcctggccggttttcccgcggaggccccc
ttgcgcctccccgcctggaagggggaggaggtcctcctccccccgggtcccctggcccta
agccggcatgctcaggaggttcaggccctttgggtggagggggctctagggcatgacccc
agccttctccttcagggcctggccttggatcccctcacggcggcggtgctggacctcagg
ggaatagaggccctctttcgcaggctggtagaggccggaaagggccttctcccttcttgg
gtaacgtag

DBGET integrated database retrieval system