KEGG   Thermus oshimai: Theos_2474Help
Entry
Theos_2474        CDS       T02346                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tos  Thermus oshimai
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tos00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Theos_2474
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theos_2474
   00650 Butanoate metabolism
    Theos_2474
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Theos_2474
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Theos_2474
   00622 Xylene degradation
    Theos_2474
   00621 Dioxin degradation
    Theos_2474
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Theos_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHEOS01:complement(270031..270951)
Genome map
AA seq 306 aa AA seqDB search
MDKVKVAILGSGNIGTDLMYKLLKNPGHMELVALVGIDPKSEGLARARALGLEASPEGIA
YILERPEIKIVFDATSAKAHVRHAKLLREAEKIAIDLTPAARGPYVVPPVNLKEHLDKDN
VNLITCGGQATIPLVYAVHRVAPVLYAEMVSTVASPSAGPGTRQNIDEFTFTTARGLEAI
GGAQRGKAIIILNPADPPILMTNTVRAIPEEEGFDREEVVASVRAMEAEVQAYVPGYRLK
ADPVFEKLPTPWGEKTVVSMLLEVEGAGDYLPPYAGNLDIMTASARRVGEVFAQHLLGVR
REEVQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtcaaggtcgcgattctaggctcgggcaacatcggcacggacctcatgtac
aagctcctcaagaaccccgggcacatggagctggtggccctggtggggattgaccccaag
tccgagggcctggcccgggctagggccttaggcctcgaggccagccccgaggggatcgcc
tacattctggaacgcccggagatcaagatcgtctttgacgccaccagcgccaaggcccac
gtgcgccacgccaagctcctgagggaggcggagaagatcgccatcgacctcacccccgcg
gcccgggggccctacgtggtgcccccggtgaacctgaaggaacacctggacaaggacaac
gtgaacctcatcacctgcggcgggcaggccaccatccccctggtctacgcggtgcaccgg
gtggcccccgtgctctacgcggagatggtctccaccgtggcctccccctccgcggggccc
ggcacccggcagaacatcgacgagttcaccttcaccaccgcccggggcctcgaggccatc
gggggcgcccagcgggggaaggccatcatcatcctgaaccccgcagaccctcccatcctc
atgaccaacaccgtgcgggccatccccgaggaggaggggttcgaccgggaggaggtggtg
gcaagcgtccgggccatggaggccgaggtccaggcctacgtccccggctaccggctgaag
gcggacccggtgtttgaaaagctccccaccccctggggggaaaagacggtggtctccatg
ctcctggaggtggagggggcgggggactacctgcccccgtacgcggggaacctggacatc
atgaccgcctccgccaggcgggtgggggaggtcttcgcccagcacctcctcggggtccgg
agggaggaggtgcaggcgtga

DBGET integrated database retrieval system