KEGG   Treponema pallidum subsp. pallidum Nichols: TP0168Help
Entry
TP0168            CDS       T00016                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tpa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpa00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:tpa00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpa00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189011..189766
Genome map
AA seq 251 aa AA seqDB search
MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEAGFDFDLCYTSFLKRA
IRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAP
PPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVVPYFEEEIKPQMISGQRV
LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEADFTLCGKRFLGNEADVAAR
AQAVADQGKSN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgtgttgatccgtcatggagaaagtgaatggaacaggctgaacctgttcact
ggttggacagatgttccgcttaccccacgtggggagtcggaagcccaggaaggaggccgc
gtactgcaagaagcggggtttgattttgacctatgctacacttctttcttgaaacgtgcc
attcgtacgctcaattttgtactccaggcactggaccgtgagtggttgccggttcacaaa
agctggaaattgaacgagcggcattatggggatctacaaggtttaaataagacagagacg
gcgcagaagtatggtgagcagcaggttagggtgtggcgtcgctcctttgatgtggctcct
cctccgcttactgtaggggacgcacgttgtccgcatactcaagcctcctaccggggggta
tgcgcgtctggtcggacgccagtacttccgtttacggaaagtttgaaagataccgttgcg
cgtgtggtgccgtattttgaagaggaaatcaaaccgcagatgatttccggacagcgtgtg
cttattgtggcgcatggtaactcgttgcgcgcactgatgaagcacatagagtctttggat
gagactcagataatggaagtaaatttgcctaccggtgtaccgcttgtctatgagttcgag
gcggattttaccctgtgtgggaagcgttttttaggtaatgaggcggatgttgcagcgagg
gcgcaggctgtggctgatcagggtaagagtaactaa

DBGET integrated database retrieval system