KEGG   Treponema pallidum subsp. pallidum Nichols: TP0351Help
Entry
TP0351            CDS       T00016                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tpa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375922..376812
Genome map
AA seq 296 aa AA seqDB search
MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMRDGKQIVVVSSGAQVA
GISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAELISRWRSAFAAHQQCV
GQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCCSDVPSVPADRRVSLSPQ
KRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDAQHVPLVTDVSALVGKTSM
GSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHLDPILSLMRGDARGTLFVPVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtgcgctttttgctgcggcaaaaaaaattgtgataaagattgggtcaaatacg
cttgcgcaggcagatggtactcctgatgaggagtttttggcggagtgtgctcgcgcctgt
gcggcgctgatgcgtgacggcaagcagatagttgtggtgtcgtctggcgctcaggttgca
gggatttctgcgctccattgcctttcatctcctcctcagggggcgggtttagagcgtcac
gaatcgcgcggcgttattccgggtgatggtgcgtcctgcaaacaggcgttgtgtgcggtg
ggtcaggcggagttgataagtcgttggcgttctgcgtttgcagcgcaccagcagtgcgtg
ggccagtttctgtgtacgaaggaggattttactgactcggaccgcgcggcgcaggtacgc
tacacgttgtcctttttgctcgagcgcagggtagtacctatccttaatgaaaatgacgcg
ctctgttgcagcgacgtcccctctgtacccgccgaccggcgggtgtccctatcacctcaa
aaaaggattggagataatgacagtctgtccgcgtttgtagcgctgttgtggcaggcagat
cttttgcttttgttgagtgacattgacggcgtgtatgacaaagacccaaaggcacacaca
gatgcgcagcacgttcctctggtgacggacgtgtcagcgcttgtgggtaaaacgagcatg
ggttcttccaatgtctttggtacgggtgggattgctacaaagctggatgctgcgcgtctt
gtcacgagggcgggaattcctctggtgctggcaaacgggcgccatctggatccgatcctg
agccttatgcgcggggatgcgcgggggacacttttcgtgcctgtttcttag

DBGET integrated database retrieval system