KEGG   Treponema pallidum subsp. pallidum Nichols: TP0351Help
Entry
TP0351            CDS       T00016                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TP0351
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TP0351
Enzymes [BR:tpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TP0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375922..376812
Genome map
AA seq 296 aa AA seqDB search
MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMRDGKQIVVVSSGAQVA
GISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAELISRWRSAFAAHQQCV
GQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCCSDVPSVPADRRVSLSPQ
KRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDAQHVPLVTDVSALVGKTSM
GSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHLDPILSLMRGDARGTLFVPVS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtgcgctttttgctgcggcaaaaaaaattgtgataaagattgggtcaaatacg
cttgcgcaggcagatggtactcctgatgaggagtttttggcggagtgtgctcgcgcctgt
gcggcgctgatgcgtgacggcaagcagatagttgtggtgtcgtctggcgctcaggttgca
gggatttctgcgctccattgcctttcatctcctcctcagggggcgggtttagagcgtcac
gaatcgcgcggcgttattccgggtgatggtgcgtcctgcaaacaggcgttgtgtgcggtg
ggtcaggcggagttgataagtcgttggcgttctgcgtttgcagcgcaccagcagtgcgtg
ggccagtttctgtgtacgaaggaggattttactgactcggaccgcgcggcgcaggtacgc
tacacgttgtcctttttgctcgagcgcagggtagtacctatccttaatgaaaatgacgcg
ctctgttgcagcgacgtcccctctgtacccgccgaccggcgggtgtccctatcacctcaa
aaaaggattggagataatgacagtctgtccgcgtttgtagcgctgttgtggcaggcagat
cttttgcttttgttgagtgacattgacggcgtgtatgacaaagacccaaaggcacacaca
gatgcgcagcacgttcctctggtgacggacgtgtcagcgcttgtgggtaaaacgagcatg
ggttcttccaatgtctttggtacgggtgggattgctacaaagctggatgctgcgcgtctt
gtcacgagggcgggaattcctctggtgctggcaaacgggcgccatctggatccgatcctg
agccttatgcgcggggatgcgcgggggacacttttcgtgcctgtttcttag

DBGET integrated database retrieval system