KEGG   Treponema pallidum subsp. pallidum Nichols: TP0537Help
Entry
TP0537            CDS       T00016                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TP0537 (tpiA)
   01230 Biosynthesis of amino acids
    TP0537 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TP0537 (tpiA)
   00051 Fructose and mannose metabolism
    TP0537 (tpiA)
   00562 Inositol phosphate metabolism
    TP0537 (tpiA)
Enzymes [BR:tpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TP0537 (tpiA)
Exosome [BR:tpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TP0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   TP0537 (tpiA)
  Exosomal proteins of melanoma cells
   TP0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(579055..579804)
Genome map
AA seq 249 aa AA seqDB search
MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVGKVLRGSNVLL
GAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGENDKLINQKVRRVLESGL
RVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCGSLMHNVTVAYEPVWAIGTGKTATPA
QANAVHAHIRSVVREMYGAAIAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAA
SFVPIARSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggctattttatcgcggggaattggaagatgcataaaacgtgtgcggaggcggtg
gcgcttgcgcaggaactcgtgcgggaattacggggtggtccgcacacatacatgattgcg
ccgagttttaccgctttagacgcggtggggaaggtgctacggggaagtaacgtacttctt
ggcgcgcaggacgtgagtagtgaagagtggggggcgcatactggagaggtatccgtcctt
caactcgaagacctgggggtacaggtagtcatcgtggggcattccgaacggcgtcatggg
cgtggggagaatgataagcttatcaatcaaaaggtcagacgcgtgttagaaagcggtttg
cgcgtcatcttatgcgtcggcgaacgactccaagagtatgaagcggggtgtaccaacgag
gtagtgggaactcaagtgcgcgcagggatggcagacgtgtgtgggtcactcatgcataat
gtaactgttgcgtatgagcctgtgtgggcaattggtacgggtaagactgccactccggca
caggcgaatgcggttcatgctcatattcggtcagtagtccgcgagatgtacggcgcggct
atcgcagaggcactgtgtattcaatacggcggatccatgaaagcggagaacgcgcgggca
ctgttggctgaagagcacattgacgggggactcattggcggtgcttcgctggaggctgcg
tcttttgttcctatcgcgcgcagcgtgtag

DBGET integrated database retrieval system