KEGG   Treponema pallidum subsp. pallidum Nichols: TP0543Help
Entry
TP0543            CDS       T00016                                 

Definition
Holliday junction DNA helicase (ruvA)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TP0543
Enzymes [BR:tpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TP0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(584926..585609)
Genome map
AA seq 227 aa AA seqDB search
MFESISGILTLHERERLCVEVHGIEWEIAVSAYSSAAFGEVGSHVKVFTWLYHREDALRL
FGFSNVQERTLFLSLTKVEGIGPKQALKVLSSISSQALCAALDTGDLCALQRIPGIGKKT
AQRMLLALKGTLALTDAASCAQSQTDDRAAHPSNLGCAPHAREIEDLVTALVQMGYDRKM
AAEVIAQESAALCSVGRSLYEEEATVLKRAILALSIAHPHAVAPAAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaagcatcagcggtatcttgacgctccatgagcgcgagcgcctctgtgttgag
gtgcatggtattgaatgggaaattgcagtgtccgcatacagtagtgctgcgttcggtgag
gttggatcacacgttaaggtctttacctggttgtatcaccgtgaagatgcgcttcgcctc
tttggtttttcgaatgtacaagagcgcacgctctttctcagtcttacaaaggtagaaggt
attggtccaaagcaggcgctcaaagttctttcgagtattagcagtcaggctttgtgtgca
gcgcttgatacaggagatttatgtgcactccagcgcataccaggcattggaaaaaagact
gcacagcgcatgctcttagcgctgaaaggtacgctcgcgctaaccgacgcggcctcttgt
gcccagagtcagacagatgatcgtgctgcacatccgagcaatcttgggtgtgctccccat
gcgagggaaattgaggatctggtaactgctcttgtacagatgggatacgacaggaaaatg
gcggcggaggtgatcgcacaggagagcgctgcgttgtgcagtgtggggcgttcactgtat
gaagaagaagcgacggttcttaaacgtgctattcttgcgttgagtattgcgcatccacac
gcggtcgcgcctgctgcagagtga

DBGET integrated database retrieval system