KEGG   Treponema pallidum subsp. pallidum Nichols: TP0632Help
Entry
TP0632            CDS       T00016                                 

Definition
tryptophanyl-tRNA synthetase (EC:6.1.1.2)
Orthology
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    TP0632
Enzymes [BR:tpa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     TP0632
Amino acid related enzymes [BR:tpa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   TP0632
Transfer RNA biogenesis [BR:tpa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TP0632
 Prokaryotic Type
    TP0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690233..691246
Genome map
AA seq 337 aa AA seqDB search
MLRVLTGDRPTGRLHLGHYAGSLGTRLRIQSEHECFFIIADLHTLTTRHGRAQLAELPAL
VRELVLDYLACGIDAQRAVIYLQSAVPEVTELAFIFANLVTVPRLQRIPSLKEMAQAANL
SELPFGLLGYPVLQAADILLARAHLVPVGKDNESHVELTREVAKRFNRLYGEVFPLPRAL
LSDCATLVGTDGQAKMSKSLGNAIFLSDDEETVRRKVRAMYTDPARTRADIPGRVEGNPV
FAYHDAFNPNTDEVAHFKERYRAGRVGDTEVKDALARALNTFLEPIRARRAQLEQQPAYL
ARVLEEGCARMRAEARKTMQRVKEAMGLSARPLVHLP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgtccttaccggagaccggcccacggggcgtctccacctcggtcactatgca
ggctcgctcgggacgcgtctgcgcatacagtctgagcacgagtgtttcttcatcatcgcg
gatctgcacacgctcactacacgccatgggcgtgcacagcttgccgagctgcctgctctc
gttcgtgagctcgtgctggactacctagcttgtggcatcgacgcgcagcgtgcggtcatt
tatctgcaatcggcggtgccagaagttacagagctggcgttcatttttgcgaatctggta
acggtgccgcgtttgcagcgcatcccttccttaaaggagatggctcaagcggcaaacctt
tctgaacttccctttggtcttttgggatatcccgtacttcaagcggcggacattctgctg
gcgcgggcgcatcttgtgccggtaggtaaagataatgaaagtcacgtagaactgacgcgc
gaagttgcaaagcgtttcaatcgcctctatggggaggtctttccattgccgcgtgcactc
ctcagtgactgcgccactctcgtgggaactgacggacaagcgaaaatgtctaaaagtttg
gggaacgcgatttttctctcggacgatgaagagacggtgcggcgcaaggtccgtgcgatg
tacacagatcctgcgcgcacccgggcagatataccaggacgcgtggaagggaatccggtg
tttgcgtaccacgatgcgttcaacccaaacacggacgaggttgcacattttaaagagcgg
tatcgcgctgggcgcgtgggagacacagaagtgaaagacgctcttgcgcgcgccttgaat
acgtttttagaacccatccgcgcacgccgtgcacagttagaacagcagcctgcgtacctt
gcacgcgtattagaggaaggctgcgcgcgcatgcgtgctgaagcacgcaaaaccatgcag
agagtaaaagaggcgatgggtctttctgcacgtcctctcgttcatctgccgtag

DBGET integrated database retrieval system