KEGG   Treponema pallidum subsp. pallidum Nichols: TP1004Help
Entry
TP1004            CDS       T00016                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TP1004 (recR)
DNA repair and recombination proteins [BR:tpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TP1004 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1092553..1093158)
Genome map
AA seq 201 aa AA seqDB search
MIPAIEEVVEHLSRLPGIGVKLATRLAYHLLKRDPAEAQVLARGIACLHERVYRCVCCGA
FCEGRTCALCTDASRDRGIICVVERAQDVEMMAGVGEYRGLFHVLGGVIAPLEGVGPDQL
RIAALLKRLQESSVREVILALNPTVEGDTTALYVQKILANFPVIVTRLASGIPVGGDLEY
IDRTTLAHSLRGRRPLDCSEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgataccggcgattgaagaagtagtggagcatttatctcgtctcccgggtattggagta
aagctggcgacgcgccttgcctatcaccttttgaaacgtgaccccgctgaagcgcaggtt
cttgcgcgcgggattgcgtgtttgcatgagcgcgtatatcggtgtgtgtgctgcggtgct
ttctgtgaggggaggacctgcgcgttgtgcacggatgcgtctcgggaccgaggcatcatt
tgtgtagtggagcgtgcgcaggacgtggaaatgatggcgggtgtgggggagtatcggggt
ttattccacgtgttaggaggagtcattgcaccgcttgagggggtcggtcctgaccagctc
cgtattgcggcgttgctgaaacggttgcaagagagttcagtacgggaagttattctggcg
ttgaatcccaccgtggaaggggataccaccgccttgtatgtgcaaaaaatccttgcaaac
tttccggtaatagtaacgcgtctagcgtctggtatccccgtagggggggacttagaatat
atcgaccgaacgacattggcgcacagcctgcgtgggcgccggccacttgattgctcggag
gcttag

DBGET integrated database retrieval system