KEGG   Treponema pallidum subsp. pertenue CDC2: TPECDC2_0537Help
Entry
TPECDC2_0537      CDS       T01749                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpc  Treponema pallidum subsp. pertenue CDC2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tpc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(581034..581783)
Genome map
AA seq 249 aa AA seqDB search
MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVGKVLRGSNVLL
GAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGENDKLINQKVRRVLESGL
RVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCGSLMHNVTVAYEPVWAIGTGKTATPA
QANAVHAHIRSVVREMYGAAIAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAA
SFVPIARSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggctattttatcgcggggaattggaagatgcataaaacgtgtgcggaggcggtg
gcgcttgcgcaggaactcgtgcgggaattacggggtggtccgcacacatacatgattgcg
ccgagttttaccgctttagacgcggtggggaaggtgctacggggaagtaacgtacttctt
ggcgcgcaggacgtgagtagtgaagagtggggggcgcatactggagaggtatccgtcctt
caactcgaagacctgggggtacaggtagtcatcgtggggcattccgaacggcgtcatggg
cgtggggagaatgataagcttatcaatcaaaaggtcagacgcgtgttagaaagcggtttg
cgcgtcatcttatgcgtcggcgaacgactccaagagtatgaagcggggtgtaccaacgag
gtagtgggaactcaagtgcgcgcagggatggcagacgtgtgtgggtcactcatgcataat
gtaactgttgcgtatgagcctgtgtgggcaattggtacgggtaagactgccactccggca
caggcgaatgcggttcatgctcatattcggtcagtagtccgcgagatgtacggcgcggct
atcgcagaggcactgtgtattcaatacggcggatccatgaaagcggagaacgcgcgggca
ctgttggctgaagagcacattgacgggggactcattggcggtgcttcgctggaggctgcg
tcttttgttcctatcgcgcgcagcgtgtag

DBGET integrated database retrieval system