KEGG   Treponema pallidum subsp. pertenue CDC2: TPECDC2_0537Help
Entry
TPECDC2_0537      CDS       T01749                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpc  Treponema pallidum subsp. pertenue CDC2
Pathway
tpc00010  Glycolysis / Gluconeogenesis
tpc00051  Fructose and mannose metabolism
tpc01100  Metabolic pathways
tpc01110  Biosynthesis of secondary metabolites
tpc01120  Microbial metabolism in diverse environments
tpc01130  Biosynthesis of antibiotics
tpc01200  Carbon metabolism
tpc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TPECDC2_0537 (tpiA)
   00051 Fructose and mannose metabolism
    TPECDC2_0537 (tpiA)
   00562 Inositol phosphate metabolism
    TPECDC2_0537 (tpiA)
Enzymes [BR:tpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TPECDC2_0537 (tpiA)
Exosome [BR:tpc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TPECDC2_0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   TPECDC2_0537 (tpiA)
  Exosomal proteins of melanoma cells
   TPECDC2_0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEZ58728
UniProt: H6KTZ5
Position
complement(581034..581783)
Genome map
AA seq 249 aa AA seqDB search
MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTALDAVGKVLRGSNVLL
GAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGENDKLINQKVRRVLESGL
RVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCGSLMHNVTVAYEPVWAIGTGKTATPA
QANAVHAHIRSVVREMYGAAIAEALCIQYGGSMKAENARALLAEEHIDGGLIGGASLEAA
SFVPIARSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggctattttatcgcggggaattggaagatgcataaaacgtgtgcggaggcggtg
gcgcttgcgcaggaactcgtgcgggaattacggggtggtccgcacacatacatgattgcg
ccgagttttaccgctttagacgcggtggggaaggtgctacggggaagtaacgtacttctt
ggcgcgcaggacgtgagtagtgaagagtggggggcgcatactggagaggtatccgtcctt
caactcgaagacctgggggtacaggtagtcatcgtggggcattccgaacggcgtcatggg
cgtggggagaatgataagcttatcaatcaaaaggtcagacgcgtgttagaaagcggtttg
cgcgtcatcttatgcgtcggcgaacgactccaagagtatgaagcggggtgtaccaacgag
gtagtgggaactcaagtgcgcgcagggatggcagacgtgtgtgggtcactcatgcataat
gtaactgttgcgtatgagcctgtgtgggcaattggtacgggtaagactgccactccggca
caggcgaatgcggttcatgctcatattcggtcagtagtccgcgagatgtacggcgcggct
atcgcagaggcactgtgtattcaatacggcggatccatgaaagcggagaacgcgcgggca
ctgttggctgaagagcacattgacgggggactcattggcggtgcttcgctggaggctgcg
tcttttgttcctatcgcgcgcagcgtgtag

DBGET integrated database retrieval system