KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0176Help
Entry
Teth39_0176       CDS       T00649                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00900  Terpenoid backbone biosynthesis
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Teth39_0176
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Teth39_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABY93849
JGI: Teth390176
UniProt: B0KBH0
Position
197851..198720
Genome map
AA seq 289 aa AA seqDB search
MKKIKVKAYAKINLSLDVLGKREDGYHEISTIMQSIDLADILEFEKSEIVKVFCNDHRVP
LGEDNLIVKVINLLKEKYQMEEGVLVKLDKRIPLAAGLAGGSADAAATIVALDKLWNLNM
SKEEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLKITSMNLLLVKPDIEISTKEIYD
KWDRLNFKSHHATVPVVQAIQEGNIYKIAENIKNDLELVTSQKYGIINKIKEELLKKGAL
GCAMSGSGPTVYGIFDDLEKLRKAYEDLKEVYSFVFFSKTIDKGLELYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtaaaggcctatgctaaaattaatttatctttagatgtattagga
aagagagaagatgggtatcatgaaatttctacaataatgcaatcaattgatttggctgat
attttagagtttgaaaaaagcgaaatagtcaaggttttttgcaatgaccatagagtacct
ttaggagaagataatttaatagtgaaggtcattaaccttctaaaagaaaaataccaaatg
gaagaaggggtgttagtcaagcttgacaagagaatccctttagctgccggccttgctggg
ggaagtgctgatgctgctgctacaattgttgcattagacaaattatggaatttaaatatg
tcaaaagaagaaaaaaaagaaattgctctgaaagtcggagcagatgttcctttctgtctg
gaaggtgggacaaagcttgcgaaaggcataggggaaatttttgaggatttaaaaattaca
tctatgaatttacttcttgtaaaacctgatattgaaatttccacaaaagaaatttatgat
aaatgggataggcttaattttaaaagtcatcatgctactgttccagtagtccaagctata
caagaaggaaacatatacaaaattgcagaaaatataaaaaatgatttagaattagtgact
tctcagaaatatggaattattaataaaataaaagaggaattgcttaaaaaaggcgcatta
ggatgtgctatgtcaggtagtggtcccactgtttatggaatttttgacgatttagaaaag
cttagaaaagcttatgaggatttaaaagaagtttacagttttgtgtttttttcaaaaact
atagataaggggttagaattgtatgaatga

DBGET integrated database retrieval system