KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0233Help
Entry
Teth39_0233       CDS       T00649                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth39_0233 (gpmA)
   01230 Biosynthesis of amino acids
    Teth39_0233 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0233 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Teth39_0233 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth39_0233 (gpmA)
Enzymes [BR:tpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Teth39_0233 (gpmA)
Exosome [BR:tpd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Teth39_0233 (gpmA)
  Exosomal proteins of melanoma cells
   Teth39_0233 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
271132..271887
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSVDVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVIPYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSKQEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VENQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagttgttttgctaagacatggagaaagcctgtggaatatggaaaacagattt
actggctggacggatgttgatttatctccaaagggcattgaagaagctcgggaaagcggc
aagactttaaaggcagaagggtacacttttgactgtgcttttacttctgttttaaaaaga
gctataagaactttgtggattgttcttgacgaattagacaggatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggcttaataaagctgag
accgccaagaaatacggagaagagcaggtaaaaatatggagaagatctgttgatgtaagg
cctcccgccttagaaaaagatgacccgagatatcccggttttgaccccagatatgctgac
ctttctgaggaagaaatcccccttactgaaaatttgattgatacaattaacagagttatt
ccatattgggagtccacaattgcaccgactataaaatcaggtaaaaaagtgctaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttctaagcaggag
ataatggagttaaatattcctacaggaattccgttagtttatgagcttgacgatgattta
aaacctataaggcattattatcttgccgatgaagagaaagtaaaagagaagaaagaatta
gtagaaaaccaaggaaagattcaagggaattcttaa

DBGET integrated database retrieval system