KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0282Help
Entry
Teth39_0282       CDS       T00649                                 

Definition
copper-translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Brite
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Teth39_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
317637..320030
Genome map
AA seq 797 aa AA seqDB search
MAEKANLKITGMSCAACATKIEKGLKSLDGVLDANVNLAIEKATVIYDPDKINICDMEKK
IEDIGYGVIKDKVELALMGMSCASCAAKIEKTLKNLPGVSNASVNFATETATVEYDSNEI
DTEKMIKAIKDIGYDAKEKTGVGIDTEKEIKEREINTLRKLVIYSAILTVPLVLSMFLVM
FKVPGGILENPWLQVFLSSPVQFIVGLRYYKGAWNNLKNMTANMDTLVAMGTSAAYFYSL
YNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEATAKGKTSEAIKNLMGLQAKTARVIR
DGQELDIPIEEVKVGDIVVVRPGEKIPVDGKIVEGSSTIDESMITGESIPVEKGVGDEVI
GATINKTGTFKFEATKVGKDTVLSQIIKMVEDAQGSKAPIQQIADKISGIFVPTVMGIAA
TTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPTSVMVGTGKGAENGILIKGGEHL
QRAGKITTIVLDKTGTITKGEPEVTDIEAFGNFTEEEILKIAGIAEKNSEHPLGQAIVNK
AKEKFKILEVPEKFEAIPGYGICITINEKEFYIGNRRLMDRQNIDITPIEDKLVNLEIQG
KTSMILASKDCVYGIIAVADTVKSDSAKAIKELQAMGIEVYMITGDNKRTAEAIAKQVGI
KNVLAEVLPEDKAEEVAKLQKMGKVVAMVGDGINDAPALATADVGIAIGTGTDVAIETSD
ITLISGNLMGIVTAIKLSKATMRNIYQNLFWAFIYNTIGIPFAAMGFLTPAIAGGAMAFS
SVSVVLNALRLRRFREG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaagctaatttaaaaataacagggatgtcttgtgcagcttgcgcaacaaaa
atagaaaaagggcttaaaagcttagatggagttttagatgcaaatgtaaatcttgcgatt
gaaaaagcaacagttatatatgatccagataaaattaatatatgcgatatggagaaaaaa
atagaagatataggatatggtgtaataaaagataaagtagagcttgcacttatgggtatg
tcctgcgcatcctgcgctgctaaaatcgaaaaaaccttaaaaaaccttcctggtgtaagc
aacgcatcagtcaactttgcgacggaaacggcaactgttgaatatgattcaaatgaaatt
gatacagaaaaaatgattaaagcgataaaagatataggatatgatgcaaaagagaagact
ggagtaggtattgacactgaaaaagagataaaggagagggaaataaatacattaagaaaa
ttggtaatatattcagcgattttaactgtcccactggtattatcaatgtttttggtaatg
tttaaagttccaggagggatacttgagaatccgtggttgcaggtgtttttatcttcacct
gttcagtttattgtgggtcttagatattataaaggggcgtggaacaatttaaaaaatatg
acggcaaatatggatactttggtagctatgggaacatctgcagcatatttttatagtttg
tacaatgtatttacaaaaccctctcatgagatacacaattacttgtattttgaggcatca
gcagttattataacgcttgtaacattgggtaagctgcttgaagctacagccaaagggaaa
acatctgaagcaataaaaaacctcatgggactacaagcaaagaccgcaagagtgataagg
gatggacaagaattagatatacctattgaagaagtcaaagtcggggacatcgttgttgta
agaccgggcgaaaaaataccagttgacggtaaaatagttgaaggtagttccacaatagat
gaatctatgataactggagaatctattcctgtagaaaaaggcgttggtgatgaagtaatt
ggtgctacaataaataaaacaggaacgtttaaatttgaagcgacaaaagtgggtaaagat
acggtactatcgcaaattattaaaatggtggaagacgcccaaggttccaaagcaccaatt
caacaaattgctgataaaatctctggtatttttgtacccacagttatgggtatagctgct
accacatttttaatctggtattttgggtatggagattttaatgcgggcataataaatgca
gtatctgtgcttgtaattgcgtgcccgtgtgcgcttggacttgcagttcccacttctgtg
atggtagggacaggaaaaggagcagaaaatggtatactcataaagggaggagaacatctg
cagagggcaggaaaaataacgacaatagtgcttgataagactgggacgataacaaaagga
gaaccggaagttacagacatagaagcttttggaaatttcaccgaagaggagatactaaaa
atagcgggaattgcggaaaaaaattctgagcatccattgggacaagcaattgtcaataaa
gcaaaagaaaaattcaaaatattggaagttcctgagaaatttgaggctataccaggctac
ggtatatgcattacgataaatgaaaaagaattttatattggcaatagaaggcttatggat
agacaaaatattgatataacgccaattgaagacaaacttgtaaatttagaaatacaaggt
aaaacatcaatgattttggcttccaaagattgtgtttatggcattatagcagttgcagat
acagtaaagagtgactcggcaaaagctattaaagagttacaggctatgggtattgaagtg
tacatgattacgggagataataaaaggactgctgaggcaatagcaaaacaagttggtata
aaaaatgtgttggcagaagtattgccagaagataaagctgaagaggttgccaagcttcaa
aaaatgggaaaggtagttgcaatggtgggagatggtattaatgatgctcctgctttagct
actgcggatgttggcatagcgataggtacaggtacagatgtggcgatagaaacctcagat
ataacgttgataagtggaaatcttatgggtattgtgaccgccataaaattaagcaaagct
accatgagaaatatatatcaaaatttattctgggcttttatatacaacacaatcggtata
ccatttgctgcaatgggatttttaactccagctatagcgggaggggcgatggcgtttagc
tcagtatcagttgttttaaatgctctgagattaagaaggtttagggagggataa

DBGET integrated database retrieval system