KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0319Help
Entry
Teth39_0319       CDS       T00649                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00790  Folate biosynthesis
tpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Teth39_0319
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Teth39_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF2785
Motif
Other DBs
NCBI-ProteinID: ABY93988
JGI: Teth390319
UniProt: B0KCE5
Position
360118..360684
Genome map
AA seq 188 aa AA seqDB search
MIDKEKIKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLHTDVKDVIKIFQEDE
HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLARIVDILAKRPQLQER
LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTDEKSRAEV
MSLINSKK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaagaaaagattaaaaaagcggtaagagacatacttgaagccataggagaa
gacccggatagggaggggctccttgagactcctgatagggttgcaaggatgtatgaggaa
atttttgctggccttcatacggatgtaaaagacgttataaagatttttcaggaggatgaa
catcaagaaataatacttgtaaaagatattccgctttattctatgtgcgaacatcatctc
ttgccttttataggagttgcccatgtagcgtatttgcctagaaaaggtagaattttaggc
ctttcaaaattagctcgcatagtagatattttagcaaaaaggccacagcttcaagagagg
ttgacaagtgaaattgcagataccataatggaagcagtgaatcccttaggtgttgccgtt
gtcattgaggcagaacatttgtgtatgacaatgagaggtatcaaaaagccgggggccaag
actgttacttctgctttgagaggaatatttagaacagatgaaaaatcaagggcagaggta
atgtctttaataaattctaaaaaataa

DBGET integrated database retrieval system