KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0320Help
Entry
Teth39_0320       CDS       T00649                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
360697..361509
Genome map
AA seq 270 aa AA seqDB search
MLFRCRDKSLEIGKKTYIMGILNMTPDSFSDGGKYNTLEKGIERALQMIEEGADIIDVGG
ESTRPGHTPVDEEEEMRRVIPVIEKLSKISNVIISVDTMKSNVALRALEAGAHIVNDVWG
LQRDPKMAEVVAKYNAGVIMMHNSNVAEYEDVVQDIIKFLQKSIEIGEKAGIDKSQMVVD
PGIGFGKTLDHNLEVMNRLEELKVLGLPVLLGTSRKSMIGKVLNLEVEDRLEGTAATVAV
GIVKGVDIVRVHDVKQMLRVAKMTDAMVRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaggtgcagagataaaagtctggagattggaaaaaaaacttacataatggga
attttaaatatgactcctgattctttttcagatgggggaaaatataatactttagaaaaa
ggcatagaaagagctcttcaaatgatagaagaaggagctgacataatagatgtaggtgga
gagtctacaaggccgggacatactccagtggatgaagaagaagaaatgagaagagttata
cctgtcattgaaaagctttcaaaaatttcaaatgtcattatatctgtggatactatgaaa
tcaaatgtggcattaagagctttagaagcaggtgctcacatagtaaatgatgtatgggga
cttcaaagggaccccaaaatggcggaagtagttgcaaaatacaatgcaggtgtaataatg
atgcataacagcaatgtagcagaatatgaagatgttgttcaggatataataaaattttta
caaaaaagcatagagataggagaaaaagcaggaattgataaaagtcaaatggtagtggac
ccagggataggttttggaaaaactttagatcataatcttgaggtcatgaatcgattggaa
gaattaaaagttttaggacttcctgtgcttttaggtacttctaggaaatccatgattgga
aaagttttaaaccttgaagtagaggatagattggaagggactgctgcaacagttgctgtt
gggattgtaaaaggggttgatattgtacgcgttcacgatgtaaagcagatgttaagagtt
gctaagatgactgatgcgatggtgagaagatga

DBGET integrated database retrieval system