KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0494Help
Entry
Teth39_0494       CDS       T00649                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00010  Glycolysis / Gluconeogenesis
tpd00030  Pentose phosphate pathway
tpd00051  Fructose and mannose metabolism
tpd00052  Galactose metabolism
tpd00680  Methane metabolism
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
tpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0494
   00030 Pentose phosphate pathway
    Teth39_0494
   00051 Fructose and mannose metabolism
    Teth39_0494
   00052 Galactose metabolism
    Teth39_0494
  Energy metabolism
   00680 Methane metabolism
    Teth39_0494
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Teth39_0494
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Teth39_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABY94160
JGI: Teth390494
UniProt: B0KD62
Position
517755..518999
Genome map
AA seq 414 aa AA seqDB search
MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIDKVYGGINGIEGIIKGNIIDIFDI
PYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYNIKYFFYIGGNDSMDAV
DKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYIATTTLELALDAEVYETK
TINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNEERFLEDVNKAYKEYGNVF
ITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEKLVKEKIYKRVKMTRLGVTQ
RCAMHLASKVDFEEAEMLGKEAVKYALFGETGKMISLVRERNYPYTVKTDIVDVDKVCNK
EKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEGLPYYINLKYAIKKQE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtatactaaaagcaattgtcttatagcacaatcgggtggtcctacagctgttattaac
tccagtctgtatggagctataatggaagcttcacgctcagagaaaattgataaagtttat
ggtgggataaacggcatagaaggtataataaaaggcaatattattgacatatttgatatt
ccctatgaaagaataaaacaaatgagatttagccctgcggctgcattagggtcgtgccga
tataggctaaaagactatttagaggatgaagaggaatacaaaaagttaatagaaattttt
aagaaatacaacattaaatattttttctacataggtggcaatgattctatggatgccgtt
gacaaaatcagtaaatatgcaagagaaataggttttgaaataaatgtaattggaattcct
aagactattgataacgatttgatgtttacagatcattctcctggttttggaagtgcggca
aaatatatagccacaactactttagaacttgctttagatgcggaagtgtatgagactaaa
acaattaacgtactcgaagtgatgggcagaaatgcaggttggcttaccgcttcttctgct
ttggttaaagaaagattgccccatttgaaacaacttatttatcttcctgagatacctttt
aatgaggaaagatttttagaggatgtaaataaagcttataaggaatatggcaatgtcttt
ataactgtatcagaaggacttatggatgaaaaagggaattacattggaagaaaagaaaat
gcttatcataaagatgcttttggtcatcctcaactgggaggagtaggagactatatagaa
aagcttgtaaaagagaaaatatataaacgtgtcaaaatgaccagacttggtgtaacgcaa
agatgtgcaatgcacttggcatctaaagtggattttgaagaagctgagatgttggggaag
gaagcagtaaagtatgcgttatttggtgaaaccgggaaaatgataagtcttgtaagagaa
agaaattacccatacactgttaaaacggatattgtagatgttgataaagtgtgtaacaag
gagaaaaaaatgcctttaaattggataaatgaagaaggtaattatgttactgaagaattt
tttgattatgcaagaccacttatacaaggagaagtgaaggtccctatggcagaagggtta
ccttattatataaacttaaaatatgcgataaaaaagcaggaataa

DBGET integrated database retrieval system