KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0578Help
Entry
Teth39_0578       CDS       T00649                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00010  Glycolysis / Gluconeogenesis
tpd00052  Galactose metabolism
tpd00500  Starch and sucrose metabolism
tpd00520  Amino sugar and nucleotide sugar metabolism
tpd00521  Streptomycin biosynthesis
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
tpd01130  Biosynthesis of antibiotics
tpd01200  Carbon metabolism
Module
tpd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0578
   00052 Galactose metabolism
    Teth39_0578
   00500 Starch and sucrose metabolism
    Teth39_0578
   00520 Amino sugar and nucleotide sugar metabolism
    Teth39_0578
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth39_0578
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Teth39_0578
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Teth39_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ABY94242
JGI: Teth390578
UniProt: B0K795
Position
617156..618094
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVDEEGRIVATGSRPTKPERGYEAVAKDIAEIALELINRTNTDIK
EIKSMGIGVPGVADSEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMDNDANVAALAEAV
FGAGRGSKSSVTITLGTGVGSGFVLDGKIYNGAHHFAPEIGHIVIGNNGVRCNCGKVGCL
ETYASATALIREGKKAAKKDPNSLILKFANGDIENITAKNVIDAAKQYDEEAIKIFNDYV
KYLAIGIVNVINMLDPEVIILGGGVANAGDFLIKPLKKEVAENILFKDLPYADIRKAELG
NDAGIIGAAILG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtgttgaccttggaggcactaatattgctgttggattggtagatgaggaa
ggacgtatagtagcaacaggcagtagacccacaaaaccagaaagaggttatgaagcggtt
gccaaggatatagcagaaatagctcttgagcttattaatagaactaatactgatataaaa
gagattaaatcaatgggtattggagttccaggagtagcagacagtgaaaagggtatagtg
atacgggcagttaatcttttttggacaaaagtacctcttgcaaaagaaataagaaaatat
attgatttgccaatatatatggacaatgatgcaaatgtagcggctttggcagaggcggta
tttggtgctggcagaggttcaaaatcatctgtgacaattactttaggcacaggagtaggg
tctggatttgttctagatggcaaaatatataacggtgctcaccattttgcacctgagatt
gggcacatagtaataggtaacaatggcgtaaggtgtaattgtggtaaagttggttgtttg
gaaacatacgcttcagctactgctttaataagagaagggaaaaaggccgctaaaaaagac
cctaactctcttattttaaaatttgcaaatggggatatagaaaatataacggctaaaaat
gtaattgatgccgcaaagcagtatgatgaagaggctatcaagatttttaatgactatgtc
aaatatttagctattggaattgtaaatgtcataaacatgcttgatcctgaagtgataata
ttaggcggcggtgtcgcaaatgcgggggattttcttataaagcctctcaaaaaagaagtg
gcggagaatattttgtttaaagaccttccttatgctgacatacgaaaagcagagcttgga
aatgatgcgggaatcatcggtgctgctatactaggttaa

DBGET integrated database retrieval system