KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0610Help
Entry
Teth39_0610       CDS       T00649                                 

Definition
(GenBank) glycoside hydrolase, clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00052  Galactose metabolism
tpd00561  Glycerolipid metabolism
tpd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Teth39_0610
  Lipid metabolism
   00561 Glycerolipid metabolism
    Teth39_0610
   00600 Sphingolipid metabolism
    Teth39_0610
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Teth39_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10
Motif
Other DBs
NCBI-ProteinID: ABY94274
JGI: Teth390610
UniProt: B0K7M5
Position
651918..654107
Genome map
AA seq 729 aa AA seqDB search
MPIHFNDKTRTFHLTAKDTSYIIHVLKNDAVLHAYFGKKIKNANIYHVLKLSHVSIDTDN
INFGNYLMLDFLPQEYPAYGNTDFRSPAYQIQLENGSTVSDLRYLSHKIYKGKPKLEGLP
ATYVENEDEADTLEIELYDKVANLKVTLIYTAFRDYDVITRSVRFENMGKEDIKLLRALS
MNVDFNDDKFDMLQLSGAWARERHVIRRPLTPGVQSIESRRGASSHQQNPFIALLRKDAD
EWHGDVYGFSLVYSGNFLAQVEVDQYKMARVSMGINPFDFSWLLKPGETFQTPEVVMVYS
DSGLNKMSNTYHKLYRNRLMRSKFKDKERPILINNWEATYFDFTEEKLKELAKEAKDLGI
ELFVLDDGWFGKRNSDNSSLGDWFVNKEKIPSGLDGLAKGINSLGLKFGLWMEPEMVSPD
SDLYREHPNWCIHVPNRPRSESRNQLVLDLSRKDVQDYIIKVVSDILESANISYVKWDMN
RNMTEIGSALLPPERQRETAHRYILGLYRILEEITTRFPDVLFESCAGGGGRFDPGMLYY
MPQTWTSDNTDAVERLKIQYGTSIVYPLISMGSHVSAVPNHQVHRITPLKTRLDVAISGN
FGFELDLTKLSEEEKDLAKKYVKKYKEIRKLIQFGDFYRLLSPFEGNETAWMFINEEKTE
FVAFYFKVLATPNDTIKRIYLKALNPDYKYALQDTGEVYGGDELMYAGIAIPQLEGDFQS
VMMHFKKEA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcattttaatgataaaacaagaacctttcatttaacagcaaaagatacaagt
tatataattcatgttttaaaaaacgacgctgttttgcatgcatattttggtaaaaagata
aagaacgcgaatatatatcacgtgttaaaattgtctcatgtaagtatagatactgataat
attaactttgggaattacctaatgttagattttttaccacaagaatatcctgcgtatggc
aatactgattttagaagtcctgcatatcaaattcagcttgaaaatggttctactgtttct
gatctaaggtacttatctcacaaaatctataaaggtaagcctaaattagaagggcttccg
gctacttatgttgaaaatgaagatgaagctgatactcttgaaatagagttatatgataaa
gtagcaaatttaaaagtaactttaatttacacagcatttagagattatgatgttatcaca
aggtcagtgagatttgaaaacatgggaaaagaagacataaaattgttaagagctttgtct
atgaatgttgattttaatgatgataagtttgacatgcttcaattgtcaggggcttgggcg
agagaaagacatgttataagaagaccacttactcctggagttcagtctattgaaagcaga
agaggtgcaagcagccatcagcaaaatccttttatagcacttttaaggaaagacgctgat
gaatggcatggagatgtttatggatttagccttgtttacagtggcaatttcttggcacaa
gtagaagtggatcaatataagatggcgagagtctctatgggaattaatccatttgatttt
tcatggcttttaaaaccaggtgaaacatttcaaacaccagaagtcgttatggtttattcg
gatagtggcttaaataaaatgtcaaatacctatcacaaactgtacagaaatagacttatg
agaagtaaatttaaggacaaagaaagaccaattcttataaacaattgggaagctacttat
tttgattttaccgaagaaaaacttaaagaacttgctaaagaagctaaagatttgggtatt
gaattgtttgttcttgacgatggatggtttggaaagagaaattctgacaattcttcactg
ggagattggtttgtaaataaagaaaagattccaagtggtttggatggtcttgcaaaaggg
ataaattctttaggtttaaaatttggattatggatggaaccagaaatggtgtctcctgat
agtgacctctatagagagcatcccaattggtgtatacatgtacctaataggccgagaagt
gaaagcagaaatcaacttgtgttagacttgtcgcgcaaagatgtacaagattatattata
aaagtagtgtcagatattttggaaagcgccaacataagttatgtaaaatgggatatgaat
agaaatatgacagagataggctctgcacttttgcctcctgaaagacaaagagaaactgct
cacagatatattcttggactttacagaatattagaagaaataacgacaaggtttcctgat
gttttgtttgaaagttgtgctggtggtggcggtcgttttgaccctggaatgctttattat
atgccccagacttggactagtgataatacagatgcagttgaaagacttaaaatacagtat
ggtacaagtatagtttatcctcttatttcaatgggaagccatgtgtctgctgtgcccaat
caccaagttcatagaataactcctttaaagactcgccttgatgtggcgatatcaggtaat
tttggatttgagcttgatttaacaaagcttagtgaagaggaaaaagaccttgctaaaaaa
tatgttaaaaagtacaaagagataagaaaattgattcaatttggagatttttacagatta
ttaagtccttttgaaggaaatgaaacagcatggatgtttattaatgaagaaaaaactgaa
tttgtggctttttactttaaagtcttggcaactcctaatgacacgataaaaaggatttat
ttaaaggctttaaaccccgattacaaatatgcattgcaagatacgggtgaagtgtatggt
ggtgatgagcttatgtatgcaggcattgcaataccacaattggaaggagattttcaaagt
gttatgatgcattttaaaaaggaggcgtaa

DBGET integrated database retrieval system