KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0611Help
Entry
Teth39_0611       CDS       T00649                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpd00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tpd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
654111..656342
Genome map
AA seq 743 aa AA seqDB search
MGRDVLNFNVDWLYIPEDLNDAYKFDFDESNFEVVSLPHANKTFPHHYFKEEDYRFVSWY
RKHFKVDERYKGKKVYIHFEGVITVAKVYVNGEFVGEHKGGYTPFEFDITEYIKYGNFEN
LIAVQVDSREHKDIPPEGHLVDYMLFGGIYRNVWLKILNDTHIKDVYFVVDKLQDSVAEI
SITTTIAGKEISNGKILTEVINKEGVVCSSVVTDIKEMQKEIVQQIKMDNPLTWHPDHPY
LYNVSVKLIAENEILDNYTFKTGIRTVEFRDDGKFYINGEPLKLRGLNRHQTFPYVGGAM
PDRVQRKDADILKYELGLNYVRTSHYPQAVSFLDRCDEIGLLVFEEIPGWQHIGDENWKN
IAKENLKEMILRDRNHPCIFMWGVRINESLDDHDFYKEMNEIAHKLDRSRPTGGVRYLRD
SEKLEDVFTYNDFIYNLEGKIQLPNHKKYMVTEYMGHMYPTKSYDNLNRLITHARLHALI
QDKQYGIPNMAGASGWCAFDYNTTSAFGSGDNICYHGVCDIFRLPKFAAHFYRSQADPHL
YGPYVFIASYLIPSFEEENGDKLLVFSNCEEVELYINDKFVKRQMPNRVDFPSLPHPPFE
FSMKECGINYMEVRVNNASITAIGLIDGKEVARHTLRPYGKPHKLILSCDDNEIMADGAD
CTRVVVSVVDENGSILPYANIPVSFEIEGEGKLIGENPLTLEAGRGAVYVKSTRKPGEII
LKAKSHYVAEESNVSIKTKSIGY
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagatgtattgaattttaatgtagattggctatatattcctgaagacttaaat
gatgcatataaatttgattttgatgagagcaattttgaagttgttagtcttcctcatgca
aacaaaacatttcctcaccactattttaaagaagaagactacaggtttgtttcatggtac
agaaaacattttaaagtagatgagagatacaaagggaaaaaggtttatattcattttgaa
ggtgttataactgttgcgaaggtttatgtaaatggcgaatttgtaggagaacataaagga
ggatatactccttttgaatttgatattacagagtatattaaatacggtaattttgaaaat
ttaattgctgtacaagtggattcaagagagcataaagatattcctccagaaggtcatctt
gtagattacatgttgtttggtggaatatacagaaatgtatggctgaaaattttaaatgat
acccatataaaagatgtttattttgttgttgataaattgcaagattctgttgctgaaatt
tcaattactacaactattgcaggaaaagaaataagcaatggaaagatattgacagaggtt
ataaataaagaaggcgttgtgtgttcatcagtggttactgacataaaagagatgcaaaaa
gagattgtacagcaaataaagatggacaatccattaacttggcatccagatcatccgtat
ttatataatgtgtctgtaaaacttattgcagagaatgaaattttagataattatactttt
aagacaggaataaggacagttgaatttagagatgacggcaaattttatattaatggtgaa
cctttaaaattgagaggattaaacagacatcagacttttccttatgttggcggtgctatg
ccggatagggttcaaagaaaagatgcagatatactaaagtatgaattgggattaaattat
gttaggacgtcacattatccgcaggctgtttcatttttggatagatgtgatgagataggt
ttgttagtttttgaagagatacctggatggcagcatataggcgatgaaaattggaagaac
attgcaaaagagaatttaaaagaaatgattttaagagatagaaatcatccttgtatattt
atgtggggtgtgcgaataaatgagtctttagatgaccacgatttttataaagaaatgaat
gaaatagctcataaattagacagaagtagaccaacaggtggtgttagatatttaagagat
agtgaaaagctagaggatgtatttacatataacgactttatatacaatttagaaggcaaa
atacaacttccaaatcacaaaaagtatatggtaacagaatatatgggtcacatgtatccg
acaaaatcttatgataaccttaatcgacttattactcatgcaaggttgcatgctcttatt
caagacaaacaatatgggataccaaacatggctggtgcatcaggctggtgtgcatttgat
tataataccacaagtgcttttggttcaggagacaatatatgctatcatggagtctgtgat
atatttagacttccaaagtttgcagctcatttttacaggagtcaagccgacccgcactta
tatggaccctatgtgtttatagcttcgtacttaataccatcatttgaggaagagaacggc
gataaattgcttgtatttagcaattgcgaagaagtagaactttatataaatgataaattt
gtgaaaagacaaatgcccaatagagttgattttcctagtttaccacatccgccttttgaa
ttttcaatgaaggaatgcggaatcaactatatggaggtaagagttaataacgcttctatt
actgcgataggtttgatagacggtaaggaagtagcaagacatacattaaggccatatggg
aaaccacataaattaattctttcttgtgatgataatgagattatggcagatggcgctgat
tgtacaagggttgttgtaagtgttgtagatgaaaatggatctattcttccttatgctaat
ataccagtatcatttgaaatagaaggtgaaggaaagctgattggggaaaatccgttgaca
ttagaggctggcagaggagcagtttatgtaaaatcgacacgaaagccgggagaaataatt
ttaaaagctaaatctcattatgtagcggaagaaagcaatgtatctataaaaactaagtca
ataggatattaa

DBGET integrated database retrieval system