KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0793Help
Entry
Teth39_0793       CDS       T00649                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth39_0793
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0793
   00020 Citrate cycle (TCA cycle)
    Teth39_0793
   00620 Pyruvate metabolism
    Teth39_0793
Enzymes [BR:tpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Teth39_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
844866..846014
Genome map
AA seq 382 aa AA seqDB search
MPVNVVMPKLGLTMKEGRVDRWLKKVGDIVKKGEEIVEVSTDKITNVVESPADGILAKIL
VNEGEIVPVATPIGIITAEGEKLEEVEKSEEKFIKATPVAKRLAKENNIDLSLITGTGPG
GRITEEDVKKFISEQKVKTEEEGPKKEVAVIEGQALEKVERMPMDNIRKTISQRMKKSWS
EIPHVTEDIKVDVTELVNLRENLNHISDNKFTYTDLIAKACVIAIKKNPVVNWSIEGEYI
IKNSSINLGIAVALDNGLIVPVVKEADKKSLLELSKNIKELSERARNNKLTPDEIIGSTF
TITNLGMYEIDSFTPIINPPESAILGVNKIYKEPVVLDDNIVIRHIIKLSLSFDHRLIDG
ATAAKFLLDLKKTLENPLSLLI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaatgtagtgatgcctaaattgggacttacaatgaaagaaggcagagtagat
agatggcttaaaaaagttggtgatattgtaaaaaaaggagaagagattgtcgaggtttct
acagataagattaccaatgttgtagaatctccagcggatggaattttggcgaagatctta
gtaaatgaaggagaaattgtaccagtagctactcctattggaataattacagctgaaggg
gaaaagttagaagaagtagaaaaaagtgaggaaaagtttataaaagctactccagtagca
aaaaggttggcgaaggagaataacatagacctttctttaataactggaacaggaccaggt
ggaaggattactgaagaagacgtaaaaaagtttatttctgagcaaaaagtaaaaacagaa
gaagagggaccaaaaaaagaagtagcagtaatagaaggacaagcattggaaaaagttgaa
agaatgccaatggacaatattcgcaaaaccataagtcaaaggatgaaaaaaagctggtca
gaaattcctcatgttacagaagatattaaagtggatgtgacagaactggttaacttaaga
gaaaatttaaatcatattagcgataataaatttacttataccgatttaattgcaaaagca
tgtgtaatagctataaagaaaaatcctgtagttaactggtctatagaaggtgaatatata
attaaaaatagcagtataaatctcggaattgcagtggctttagataatggtttaatagtt
cctgtagtgaaagaggcggacaaaaagagtctattagaattgtcaaaaaatataaaagaa
ttaagtgaaagagcgagaaataataagcttactccagacgaaataatcggaagtacattt
actatcactaaccttggaatgtatgaaatagatagtttcacgcctattataaatccgccc
gaaagtgctatattgggtgtcaacaaaatatataaagaaccagttgttctagacgacaat
attgttataaggcatattataaaacttagcctttcttttgaccatcgattaatagatggg
gctaccgctgctaaatttttgcttgacttaaagaaaacattagagaatccactatcttta
cttatttaa

DBGET integrated database retrieval system