KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0808Help
Entry
Teth39_0808       CDS       T00649                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tpd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tpd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
859098..860549
Genome map
AA seq 483 aa AA seqDB search
MKLIDILKGVKCEIKGDPNIDISGVCYDSRKAKKKYLFIAIKGFKTDGIFYVEEAIKNGA
VAVVADREIKEYPGITTVLVEDARATMAKIASNFYNNPTSKLTLIGVTGTNGKTSVTYML
KAILERQNNKVGLVGTIQNMIGDEVIPSVHTTPESLDLQELFSIMVNKGVKYVVMEVSSH
SLALNRVDECEFDIAIFTNLSQDHLDFHQNMEEYAKTKSKLFKMAKRASVINIDDKYSSM
MIESSKAKVLTYGIEDFAYVMAKDIRNSLDGVKFKVQIEDKKEEMSLKIPGLFNVYNALA
AITVADFLGISLRSVREALSQVTVKGRFEPVETGKDFYVFIDYAHTPDGIQNIMEALKEY
KTGRKILLFGAGGDRDKTKRPLMGEVAGKYADFCILTSDNPRSEDPREIISQIEEGIKKT
NCPYVVIENRKEAIRYALTNAQKDDVIILAGKGHETYQIIGNKVIPFDEREIVKEILSEG
GNK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaatagatattttgaagggtgttaagtgcgagataaaaggagatcctaatata
gacatcagtggggtgtgttacgattcccgtaaagccaaaaagaaatatttatttattgct
ataaaagggtttaaaaccgatggtattttctatgtggaagaggctattaaaaatggggca
gttgcagtggtagcagatagggaaataaaagaatatcctggcattacaacagtattagta
gaagatgctcgagctaccatggcaaaaatagcttctaatttttacaataaccccaccagc
aaacttactttaattggtgtaacaggaacaaatggcaaaacctctgttacttatatgcta
aaagcgattttagaaaggcaaaataataaagtgggcctggtggggactatacaaaatatg
ataggggatgaagtgataccttctgtacataccacacctgaatcgttagatttgcaggag
ctttttagcattatggtgaacaaaggtgttaagtatgtagttatggaggtatcgtcccat
tctttagcattaaatagagtagacgaatgtgaatttgatatagcaatttttaccaactta
tcccaggaccatttagattttcaccagaacatggaagagtatgctaagacaaagagtaag
ttattcaagatggcaaagagggcgtcggttatcaatatagatgataaatactcttctatg
atgattgagagttctaaagcaaaggttttgacttatggtatagaagattttgcttatgtt
atggcaaaggatattaggaatagtttagatggtgtaaagtttaaagttcagattgaagat
aaaaaagaagagatgtcattgaaaattcctggtttgtttaatgtctacaatgctttagct
gctattacagtggctgattttcttggtatttctttgcgaagtgtgagagaggctttaagt
caagttacagtaaaaggtcgatttgaaccggtggagacaggaaaagacttttatgtgttc
atagattatgcccatactcctgacggaatacagaatataatggaagccttgaaggaatat
aaaactgggagaaaaatacttctttttggtgctggaggagatagggataaaactaaaagg
cctttgatgggagaagttgcaggaaaatatgcagatttttgcattttgacatcagacaat
cctcgttcggaggacccaagagaaataatttcacaaattgaggaaggcataaaaaagact
aattgcccttatgttgtaatagaaaatagaaaagaagcgataagatacgctctgactaat
gctcaaaaagacgatgtaataatattagcaggcaaaggccacgaaacttatcaaattata
ggaaataaggttattccctttgatgagagagaaatagttaaagaaattttgtctgaaggt
ggtaataaatga

DBGET integrated database retrieval system