KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0850Help
Entry
Teth39_0850       CDS       T00649                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth39_0850
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Teth39_0850
Enzymes [BR:tpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Teth39_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
900477..902276
Genome map
AA seq 599 aa AA seqDB search
MFGYAGKILRVNLTERKFKFEDLNLELAKKYIGGRGLASKIFMDEVDPNVEPLSPENKLI
IATGPLTGTPVPTGGRYMVITKSPLTGTIACSNSGGYFGAELKAAGLDMIIFEGKAESPV
YVAIEDDKVEIRDASHLWGKLVSETTDELKKEYGDKSKVLCIGPAGEKLSRIAAVMNDYD
RAAGRSGVGAVMGSKNVKAIVVKGSKGIKLYDKEKVREVARNKTKMLRENGVTGEGLPTY
GTAVLVNIINEHGIFPVANFQRAYTEHADKISGETMTREILVRKNPCYGCPIACGRWIRL
KDGREVGGPEYETLWAFGADCEVYDINAIAEANYWCNEYGLDTISTGATIAAAMELYEKG
YIKDDEIEKDGYSLKFGDAEAVVGWVKKIGAREGFGDKMAEGSYRLCESYGVPELSMSVK
KQELPAYDPRGAQGHGLEYATSNRGGCHVRGYMISPEILGIPQKLDRFSLEGKAEWVKTF
QDLTAVIDSLGLCLFTSFALGAQDYVDLVNAVCGTDYTAETLLEVGSRIYTLERLFNLKA
GIDPKEDKLPKRLLEEPIPEGPSKGHVHKLSELLPKYYEVRGWDDNGYPTKETLQKLGI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgggtatgccggcaagatattgagagttaacttaacagaaaggaaattcaaattt
gaagatcttaatttagaacttgcaaagaaatacataggcggaagagggcttgcaagcaag
atatttatggatgaagttgatccaaatgttgaacccctaagtccagaaaataagttaata
attgcaacaggaccacttacaggaacaccagttccaactggtggaagatacatggtaatc
actaaatcaccgttaacaggaactattgcatgttcaaattcaggtggatattttggtgca
gaattaaaggcagcagggcttgatatgattatttttgaaggaaaggcagaaagcccagtt
tatgttgcaattgaagatgataaagttgaaatcagagatgcatcacatctatggggaaag
cttgtttctgaaacaaccgatgaacttaaaaaagaatatggtgataaatcaaaggttctt
tgcataggacctgcgggtgaaaagctttctaggattgcagcggttatgaatgactatgat
agagcagcaggacgttctggtgttggtgctgttatggggtctaagaacgtgaaggcgata
gttgtaaagggttccaaagggattaaattatacgataaagagaaggttagagaagttgct
agaaataaaacaaagatgcttcgcgaaaatggagttacgggtgaagggctaccaacttat
ggaacggcagttcttgtcaatataatcaatgaacacggaatttttccagttgctaatttc
caaagggcctatacagaacatgctgataaaataagcggagaaactatgacaagggaaata
cttgtgagaaagaatccttgttatgggtgtccaatagcttgtggaagatggataagatta
aaggatggccgtgaggtaggaggtcctgaatacgaaactctctgggcatttggtgcagac
tgtgaggtttatgatataaacgctatagctgaagcaaattattggtgcaatgaatatggt
cttgatactatttcaactggagctactattgcagctgctatggaattatatgaaaaggga
tatataaaggatgatgaaatagaaaaagatggatattccttaaaatttggtgatgcagaa
gctgttgttggatgggttaaaaagataggtgcaagggaaggatttggagataagatggca
gaaggttcatatagactttgcgaaagctatggtgtgccagaactttcgatgtcagttaaa
aaacaagaacttcccgcttacgacccaagaggagctcaaggacatggacttgaatatgcg
acttctaacagaggtggttgtcatgtaagaggatatatgatatctcctgaaatattaggt
atacctcaaaagcttgatagattttctcttgagggaaaagctgaatgggttaaaacattc
caagatttaactgctgttatagattcgctgggactgtgcctatttacatcttttgccctt
ggtgctcaagattacgttgaccttgtaaatgcagtttgcggaactgattatactgcagaa
acattattagaggtaggctcaaggatatacacattagaaaggctgtttaatttgaaggca
ggaatcgatccaaaagaggataaactgccaaagagacttttagaagagcctattcctgaa
ggcccatctaaaggacatgttcataaattatcagaactgttaccaaagtattatgaggta
agaggatgggacgataatggatatccaacgaaagaaactttacaaaaattgggaatttga

DBGET integrated database retrieval system