KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0893Help
Entry
Teth39_0893       CDS       T00649                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Teth39_0893
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth39_0893
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Teth39_0893
Enzymes [BR:tpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Teth39_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
945261..946436
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKEDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKRLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVTTGTKTLKDAVNEAIRDWVTNIDN
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAAAMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLTKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggtcagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaagaagataaagatttcatggaagaa
tacaggtactatttgagggaatattcaggaaggcctacacctttgtattatgcagagaat
cttactaaaaggcttggtggggcaaaaatttatctaaagagggaagacctaaaccacaca
ggagctcataagataaacaacgtattgggacagattttgttagcaaaacggatgaataaa
aagagagttatagcagaaacaggagctgggcagcatggagttgcaacggctaccgctgct
gcgatgtttgggatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaacgtctttagaatgaaacttttaggtgcaaaagtgacgccagtaactacagggaca
aaaacccttaaagatgcggtaaatgaagcaataagagattgggtgacaaatatagataat
actttttatgtgataggttctgttgttggtcctcatccttatcctacaatggtgagagat
tttcaaagagtgataggggatgaagcaaaagaacaaatacttcaaaaagaaggaagactt
cctgattatgtgattgcttgtgttggtggaggcagcaatgcaatgggaattttctatccc
ttcattgaagataaagaggtaaaattgataggagtagaagcagccggagaagggattgag
acagggaaacatgcagctgcaatggcgaaaggctctgtaggagtattgcacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccagtatactctatatctgcagga
ctggattacccaggtgtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagtgctcacgctttggcatatgctatgaaactggctcca
aatttaacgaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcaaaagtattgggggtggagttatga

DBGET integrated database retrieval system